Graffiti

Cette page est là pour accueillir vos commentaires.

This page is devoted to your comments. Vous devez taper du texte simple. Seules sont reconnues les ancres.

de @cachot :

Les commentaires apparaissent ici. On peut mettre des pointeurs, par exemple vers ma page, le texte devrait resister meme en cas <A href="http://weblifac.ens-cachan.fr:80/~rosmord/"> d'oubli

de dufourd@lifac :

BisouX de ta grosse Loulotte!

de @165.95.24.101 :

J'HABITE AU TEXAS, LES ETATS-UNIS, ET J'AIME L'EGYPTE!

de @gaston :

ZAZA n'est plus la...

de @piweba5y.prodigy.com :

Why are the names in cartouches? Thank you for considering us royalty but do you think it would not be better to not list them in cartouches.

de @dialup-2-87.gw.umn.edu :

Thank you for your enjoyable netsight.

de @dal18.onramp.net :

The "Name in Hieroglyphics" was great! I have been a huge fan of Ancient Egypt for some time, and I could never quite figure out how to write my name. Thanks!

de @www-a2.proxy.aol.com :

thank you fro showing me this . this is my major and i love egypt

de @194.3.46.1 :

coucou, je suis dans un cyber café... alors que toi t'es toujours dans ta salle ou la clime marche meme pas... t'as de la chance c'est bientot l'hiver

de @cachalot :

C'est de la diffamation ! elle marche très bien, la climat !

de @www-c3.proxy.aol.com :

Thank You for the opportunity to use the hieroglypic name translator! Ancient Egyptian certainly is the most visually beautiful language to have ever existed! Especially when painted in color!

de @carouge.dmi.usherb.ca :

salut Loulotte, moi c'est Boulotte!

de @lifac :

essai

de @client-71-94.online.apple.com :

Thanks for the "name in 'glyphs"! This is most interesting and the language/pictures interest me for artistic purposes! KHaas3@aol.com

de @piweba3y.prodigy.com :

I must say, I have my nametag for school written in heiroglyphs, and everyone loves it! I've always enjoyed the stories of Egypt, and this page adds to it!! @->--

de @pstnbank.mke.fullfeed.com :

Thanks for the info. I'm sure the sixth grade social studies class will enjoy their tour through the tomb, and writing their names in hieroglyphs. Meri - Stone Bank WI USA stnbank@mke.fullfeed.com

de @ptm19.montana.com :

bonjour, j'adore cette page. Beacoup merci

de @ptm19.montana.com :

Je ne parle pas un beaucoup de francais, mais j'adore cette page. Je m'appelle Galadrielle. Merci

de @stkitts.ensil.unilim.fr :

simple essai

de @piweba3y.prodigy.com :

My son had a school assignment to write his name in hierglyphics and your "page"has helped a great deal. Thank you! from Massachusetts, USA

de @slip-pc124.ulb.ac.be :

BRAVO ET A BIENTOT

de @slip-pc124.ulb.ac.be :

BRAVO ET A BIENTOT GHARBI K de BRUXELLES

de @slip-pc124.ulb.ac.be :

BRAVO ET MERCI GHARBI K & W DE BRUXELLES

de @houston-1-6.i-link.net :

My name is Jason. I am eight. I am hoping you will talk to me about ancient egyptian gods. I don't knoe French. My mom will help me. I am in America. I go to Hidden Hollow Elementary school and I am studying ancient Egypt. I would like to know your favorite god? will you E-mail me at LFish@iwol.com Thank You Jason PS My favorite god is Re

de @www-e7.proxy.aol.com :

This is a very interesting page. I am taking a class in translating Egyptian Hieroglyphics and found this page to be enjoyable. Thanks for taking the time to make it! :D See ya on the net!

de @wei-408-13.circa.ufl.edu :

I have always wanted to see my name in hieroglyphics, thank you for giving me the chance!! Leslie at U of F

de @hp6.lri.fr :

Je vois avec plaisir que LA RECHERCHE avance tres tres tres fort au LIFAC. Bravo Serge! En plus, je decouvre avec joie que certains des graffitis sont TRES personnalises. Je le NOTE!

de @ppp16.micronet.fr :

C'est cool, joli boulot.

de @inter043.internet.com.mx :

esta buena esta pared de graffiti, la verdad me gusta en otras home pages deberían de hacerlo, a mi me gusta mucho todo lo que tenga que ver con Egipto, es una ciudad mágica y una civilización admirable.

de @pm2_19.gdi.net :

Hi Serge, I am just a hobbyist, but am trying to learn Egyptian all by myself. Your page was like finding a treasure trove. Thanks, Dr. J. drj@gdi4.gdi.net

de @128.42.74.109 :

Your home page is great! I love the name writing in hieroglyphics. Thanks. Kathleen Dillon

de @www-c2.proxy.aol.com :

I enjoyed your page and am now going to check whether the hieroglyphics this search produced are the same as those on the jewelry I bought when in Egypt! If there is a difference, I suspect you are right and the jewelers were wrong.

de @206.97.152.106 :

Outstanding!

de @pppd058.compuserve.com :

thanks for the great heiroglyphics converter signed: the 6th grade rlc class Hewitt Trussville Middle School Trussville Al.

de @ts900-211.singnet.com.sg :

I am a translator for Chinese and English, your hieroglaph is great. Fortunately I don't have to learn such a dfficult language. Anyway, What is your opinion to the movie "Star Gate"? Do you read Rosetta Stone? my e-mail: jackang@singnet.com.sg

de @206.106.142.20 :

Super ``hot''votre site

de @198.188.63.106 :

Cool WebPage

de @139.179.81.100 :

thank you...

de @kursus5.natmus.min.dk :

Nice program - I like your hieroglyphs

de @s02-pm04.mursuky.campus.mci.net :

Did my name. Much fun. Printed it out and will save it. Thank you!

de @pm0-55.hal-pc.org :

This is a pretty neat page! -Sabrina

de @muninn.ismennt.is :

I live in Iceland=Ég bý á íslandi =j'habite au islandé=Jeg bor i Island=je suis étudian, je suis dix-neuf ans et je travailles á un gallerie d'art.

de @dol33.dol.net :

educate...don't obituate!!!

de @ntsa29.whidbey.com :

COOL

de @bra04.areacom.it :

Thank you for the ours names translated into the Egiptian Ancient Graffiti. Best wishes from Sara, Fiorella and Marzio. We came from Italy.

de @piweba4y-ext.prodigy.com :

THE KING OF TUT DIED VERY YOUNG, WITH A LOT OF GOLD IN HAND. HE WENT TO THE AFTERLIFE WHERE HE PLAYS IN A DISCO BAND.

de @iad_ppp0105.iamerica.net :

hello Serge love your pages I typed my name inand it match the cartouches I bought while in Athens. I wanted to know if there are any programs that run under windows95 fromat that can do the same? It can be a big help to my t-shirt busness. if so e-mail me at "logic357@iamerica.net thank you

de @152.157.23.200 :

I would like to know more about the Egyptian god Anubis

de @www-a2.proxy.aol.com :

I really enjoyed writting my name in hieroglyphics. Were the heiroglyphics on the movie StarGate real?

de @150.216.67.23 :

why the hell dont you just make your damn graffit wall simple, you professors try to make things difficult for your students. i just wanted to find out how many damn pyramids there were and i had to read bull shit and never found the answer

de @lifac5 :

Local answer for the two previous graffiti : 1) the graffiti wall is written by this site's visitor themselves, it's not an information ressource. 2) About Stargate : the hieroglyphs were about the best thing in the movie. They hired an egyptologist to write them, as well as the "ancient egyptian" the people spoke.

de @192.197.167.73 :

J'ai aime A Short Introductoin to Hieroglyphs. J'avais cherche pour quelque chose de cette sorte pendant un ou deux ans. I am looking forward to trying out An Egyptian Reading Book and The Story of King Kheops and the Magicians from your bibliography. - Kate Stange.

de @tqg8.upc.es :

Good !!. It's nice to find interactive sites on the internet... and more if the results are so simple but pretty and interesting.

de @aj131.du.pipex.com :

I am interesred in good resources of hieroglyphics and their interpetation. My email is honeill@paston.co.uk Thanks/bien merci!!

de @poppy.hensa.ac.uk :

Why begins the History of Culture and Civilization of Europe always with Greece ? If you're thirsty for truth look at the history of KEHMET.

de @isnet.is.bgsm.edu :

This rules

de @aarh4.pip.dknet.dk :

Great idea! - Do you know a heiroglyphs-font for the Mac? If so please contact me at ´clayhill@pip.dknet.dk´ Thank you, and keep up the good work! Morten Borg, Denmark.

de @porta18.chattanooga.net :

Message from: tquark@chattanooga.net Question: Does anyone know of a citation in Egyptian literature or from any documentary source of the phrase"evening and morning" to indicate an indefinite period of time?

de @tornade.ere.umontreal.ca :

Super comme site! Salutations du Québec

de @tornade.ere.umontreal.ca :

Super comme site! Salutations de l'Ecole de bibliothéconomie et des sciences de l'information de l'Université de Montréal

de @sy-a03-pool-3.tmns.net.au :

Hi There! Can you tell me how two different names I entered ended looking identical to each other? The names are Charlles Andres Sant and Christopher John Vassallo. My email is csant.msn.com Regards cas

de @ts1-06.f007.quebectel.com :

Salut c'est Kate et jonathan on est du Québec et on adore cette page.

de @ccmitp12.univ-lyon1.fr :

Ma copine adore l'Egypte! Bon,c'est pas mal mais je prefere mater autre chose...

de @192.217.67.18 :

This is the most wonderful thing yet that I have been able to get on Internet! Oh what a fantastic world in which we live! Catherine Packard, Southern Illinois very own pseudo-Egytologist

de @www-d1.proxy.aol.com :

How can you not love an Egyptian Page?

de @www-d1.proxy.aol.com :

How can you not love an Egyptian Page?

de @www-c1.proxy.aol.com :

This is the greatest web site I have every seen. My son (7 years old) just became interested in Egyptology and hieroglyphics after watching a TV documentary. Providing his name in hieroglyphics may have excited him to the point of making a Egyptologist out of a 7 year old!

de @arnet-217.arn.net :

seanord@arn.net Thank you very much for the info.

de @losh.chem.kuleuven.ac.be :

jessika moors

de @gateway.creditmutuel.fr :

Je trouve votre travail formidable... bonne continuation...

de @www-j3.proxy.aol.com :

This is a great site, I am making it one of my favorite places, and I welcome e-mail from anyone interested in Egyptian Culture and language.

de @bergen404.telepost.no :

Congratulations from Norway! This is the best site on the net,

de @pl_32.eclipse.net :

Cool Page! Fun and witty.....

de @ppp036-sm0.sirius.com :

I know heiroglyphics, and when I saw what you thought it was, I knew that that was not my name.

de @ppp036-sm0.sirius.com :

I know heiroglyphics, and when I saw what you thought my name was, I knew that that was not it.

de @r44-66.adinet.com.uy :

Muchas gracias desde Uruguay. Merci

de @brt-fl1-04.ix.netcom.com :

How can I get a copy of your hieroglyphic program? Any chance??? Regardset Merci

de @brt-fl1-04.ix.netcom.com :

How can I get a copy of your hieroglyphic program? Any chance??? Regards et Merci fmk007@email.mot.com

de @152.158.16.35 :

Je suis à la recherche pour ma fille en classe de 5ème d'une photo de la pierre de Rosette. Aussi surprenant que celà soit, je n'en ai trouvé aucune sur le WEB. Si vous disposez d'une photo digitalisée, pourriez vous me l'envoyer à mon E-mail: MDENISSE@vnet.ibm.com D'avance merci,

de @alinga.newcastle.edu.au :

"So in what was nominally a democracy, power was really in the hands of the first citizen."(Thuc. 2-65), nothing to do with Egypt, but hey who cares!

de @r106m7.hs.gettysburg.edu :

Thanks for putting that thing on your page that translates your name in heiroglphics. I just did a bunch of my friends names. It's really cool!

de @www-k2.proxy.aol.com :

what great fun!

de @rasm15.dorn.computerhaus.at :

hallo Ihr Ärsche

de @rasm15.dorn.computerhaus.at :

sorry

de @www-12-175.gnn.com :

love your site...it's unusual. I am an opera singer and my net page is visited by people who speak any number of languages. If you want to be put on the page e-mail me at hiyakev@gnn.com or visit my page at: http://members.gnn.com/hiyakev/bio.htm

de @169-15-228.ipt.aol.com :

HHE

de @200.20.170.134 :

Very well. Congratulations.

de @206.203.16.206 :

One word:COOL!

de @206.203.16.206 :

jhtcfcvgvrdv ghcr

de @bootp-15.marcy.brown.edu :

Nfrwy! You presented a paper at the Bordeaux conference? I wrote one that Hans van den Berg presented (on Unicode encoding of hieroglyphics--but it's kinda out of date already). When my thesis gets done (*if* my thesis gets done), I may have a copy of CT335/BD17 in a format you can use, if you want it. Anyway, it's cool to find another Egyptology student with a sense of humor. =) -Šw-m-tp.f

de @bootp-15.marcy.brown.edu :

Nfrwy! -Šw-m-tp.f

de @www-d4.proxy.aol.com :

The Walls have many ears! Time is short and life is shorter. Walks I have left my steps , I hope have brought joy not sorrow. So Love those who are closest to you.

de @www-k2.proxy.aol.com :

Merci/thank you. Cela fait plaisir de lire un peu de Francais sur AOL

de @fish.marlborough.la.ca.us :

j'aime votre "web page" et si je pouvais parler francais i would write my comments in french, are you french? or do you just think that you are too cool to write in english or something tu est tres stupied, non?

de @www-h3.proxy.aol.com :

thank you

de @ip219.tol.primenet.com :

Bonjour. Je parle un peu Francais. J'aime votre WWW page et l'histoire d'Egyptian. Je m'appelle Sally Renee et mon gran gran gran pere s'appelle Pierre Gentieu au Orthez, France. J'habite au Stony Ridge, Ohio, aux etats unis. Je suis une professeur assistant de graphics computer. macmom@mailhost.primenet.com

de @www-e8.proxy.aol.com :

This was fun. I enjoyed seeing my name in symbols.

de @205.216.184.22 :

You did a wonderful job on detailing the intricacies of hieroglyphics. Very well written, and the graphics were wonderful as well. Thanks for all the stimulating information.

de @205.167.46.58 :

Dmitriy

de @129.78.73.186 :

it's cool!

de @129.78.73.186 :

it's cool!

de @dialup-2-143.gw.umn.edu :

Huh?

de @202.184.73.22 :

Fantastic! It is nice to have name written in hieroglyph. Best place for those interested in ancient Egypt. Keep up the good work!!

de @169-115-183.ipt.aol.com :

There is a problem with your system.The name on the screen is a different picture for each different name BUT when you go to print out the different pictures for each name you get the same picture for all different names(it seems it's the first name-picture combination doesn't erase even if you click erase)

de @www-h8.proxy.aol.com :

Great sight

de @diala08.aei.ca :

salut! j'ai beaucoup aimé ta page. Question, comment s'assurer qu'on écrit bien phonétiquement? dans mon cas, par exemple, Guy Verville. Devrait-on dire gi vervill, ghi vervil, etc...

de @white.lambton.on.ca :

Thank you for creating this thoroughly enjoyable page. I have always thought that heiroglyphics were the most stunningly beautiful way of communication.This gives me a chance to enjoy this language

de @white.lambton.on.ca :

Thank you for creating this thoroughly enjoyable page. I have always thought that heiroglyphics were the most stunningly beautiful way of communication.This gives me a chance to enjoy this language

de @s17-pm07.auburn.campus.mci.net :

i like this

de @www-d1.proxy.aol.com :

I used your name system to design our wedding bands (Love, happiness, tranquility) THANK YOU!!!!

de @cust30.max7.indianapolis.in.ms.uu.net :

I love your wall. It has simplified ancient writing in terms anyone can understand. I've tried Budge & Gardiner but yours is the one that finally cracked my wall. Life, Health & Prsperity. Douglas Lowry, Dayton , Ohio, USA

de @204.101.239.105 :

This is the most amazing site I have ever surf. Thank you !!!!

de @inf044k1.ud.nettuno.it :

Je suis un étudiant italien et j'aime l'Egypte.

de @port9.asis.com :

Hi, I'm doing a report on Egyptian Hieroglyphics and I need to interveiw someone to get an A. Can I interveiw you through E-mail? My name is Alexis (I'm 14 and in ninth grade). My mother's E-mail adress is Susan@asis.com Please write back. PS I like your web page.

de @ppp-66-37.dialup.winternet.com :

thanks for the help in hierogliphics from clare in 4th grade.

de @pc12.ppp.xtec.es :

Endavant. També a Catalunya ens agraden els jeroglífics. Thank you

de @usr4ip53.azstarnet.com :

Your study of hieroglyphics is one of the most interesting I have found on the Internet. I look forward to seeing more in the future. Cathy Deaubl cdeaubl@azstarnet.com

de @van-as-06b16.direct.ca :

Stuart Eckley

de @stokes.math.psu.edu :

very good site!

de @magi04p10.magi.com :

EXCELLENT IDEA. I THINK IT IS ONE OF THE MOST INTERESTING WEB PAGE I EVER SEEN. I AM RETIRED SCIENTIST WORKING AS A FREELANCE TRANSLATOR, AND WEBPAGE MAKER. PLEASE PERMIT ME TO PUT A LINK TO TO YOUR HYEROGLYPH TRANSLATOR TO OUR TRANSLATOR WEBPAGE. HOW ABOUT TO CONSTRUCT A WEBPAGE FOR ALCHEMIST SIGNS?

(answer to the previous post)

Anyone who wants to put a link to my pages is welcome ; I only ask to be credited with my work.

de @blinky4.transdata.ca :

PRETTY DAMN GOOD!! THANX I NEEDED IT FOR SCHOOL!!

de @linea11.datasys.com.mx :

I have read your article about hieroglyphs and I liked it very much, congratulations from Mexico; Leonor

de @ppp-294.ihug.co.nz :

hi

de @ix-mar-wv1-16.ix.netcom.com :

nice web page. I'll be visiting again. Tom Rote

de @gab.intrepid.net :

HI MISTER GRAFFITI WALL

de @gab.intrepid.net :

THIS RULES

de @hoohoo.cac.washington.edu :

Hi!

de @hoohoo.cac.washington.edu :

I like being able to see what my name would look like in ancient Egyptian. Keep it up. Some girl out in cyberspace

de @slip202-135-5-112.jk.id.ibm.net :

It's nice to know about this things. I loved it so much !!!

de @ppp48.erols.com :

Cyberbonjour! je travaille pour une groupe a Washington DC avec des clients a l"Egypte, alors ce pays m'interesse - la presente ainsi que l"histoire.

de @mar1-01.planete.net :

sympha la traduction enfin un truc original Salut ramses :-)

de @hd59-016.compuserve.com :

Ive been trying to translate a threatening letter written by an Egyptology student. If anyone can help, please e-mail me at: tasianyc@aol.com. Serge, wonderful site, I almost forgot why I was here.

de @mikopwmac.u-strasbg.fr :

Salut ! super d'avoir fait cette page et (pour l'instant en partie) bilingue! Comme le tu vois a mon adresse, je suis aussi une chercheur francaise ... mais je suis arrivee a ta page par des moyens super detournes : Apres avoir lu les nouvelles Sud-africaines, j'ai clique sur les pages Human languages (qui permettent un acces rapide au infos en Afrikaans) et j'ai vu ton serveur ! Whaou, qu'elle bonne idee pour "populariser" tes recherches ! Bonne continuation et merci pour ta vulgarisation sympa !

de @d1101.sth.pi.se :

Cool site man, love the Egypt... seeya on the web! chrisF1

de @port_b8.worldcom.ch :

J'ai commencé à étudier un peu les hiéroglyphes avec l'excellent livre de Christian Jacq que vous connaissez sûrement "Le petit Champollion illustré". J'aimerais beaucoup trouver une police de hiéroglyphes pour PC, pouvez-vous m'aider ? Merci d'avance mailto:cst@worldcom.ch - http://home.worldcom.ch/~cst

de @johnny19.echo-on.net :

I will be awaiting the finished product with much excitment

de @lancelot.enssat.fr :

Merci pour votre superbe site sur les hieroglyphes,enfin une page de qualite sur le web!!!

de @npxy.openlink.com.br :

Achei que sua HomePage foi maravilhoso I thought your homepage was marvellous. Because you provided the quite wonderful exec on hieroglyph generation.

de @vision18.vcn.com :

You page is WONDERFULL! I loved every part. Thanks! Would you e-mail me if you find any information on HATSHEPSUT? She is my favorite Anchient Egyptian pharoah. I am currenly working on a fiction story on her life. Would you like a sneak peak? If so....e-mail me at tdidier@vcn.com. Thanks, Nikole L. Didier

de @bengt.algonet.se :

Cool - hope you extend it, especially the theoretical part. I'll be back.

de @206.170.44.150 :

The first interesting thing I've found on the NET

de @proxy1.hkstar.net :

Ca fait plaisir d'utiliser les travaux de l'ENS Cachan a partir de Hong - Kong ! Je connaissais vos travaux en CFAO mais pas en recherche egyptienne ! P.Cronert

de @cust14.max1.san-francisco.ca.ms.uu.net :

Excellent, thankyou. I had been looking for good information on Hieroglyphs when I happily stumbled upon your work.

de @hifi.magna.com.au :

it's been wild. this is a great idea

de @user-168-121-149-67.dialup.mindspring.com :

I just tapped into your site, and I'm going to enjoy delving into its contents. By the way, did you have a chance to visit "The Splendours of Ancient Egypt" Exhibit in FLA?? More to follow later... Merci mille fois, Serge... cat514

de @204.182.126.24 :

excellent site

de @bullet.iprolink.ch :

Pas moyen de dessiner en ecriture antique, Bravo pour le traducteur.

de @dynip12.efn.org :

<a href="http://www.efn.org/~garl_p_s/Cathead/CatheadPage.html"><img src="http://www.efn.org/~garl_p_s/Cathead/Pictures/smlcat.gif"></a><alt="-MEOW-"> This is a great page I'm very pleased to find it. (note: not the aforementioned link...the hierglyphic one :) )

de @v13.dialup.peg.apc.org :

Great Page, but I'm after information on heiroglyphics found in Australia. There is a major find yet to be disclosed that I have seen. I am in contact with some geoloigists that I met on site.I have been communicating with Karine Lemon from France . If you wish to know more, email me, I can send full drawings of the heiroglyphs. MANY THANKS

de @v13.dialup.peg.apc.org :

Sorry. EMAIL address for above letter is tsmith@peg.apc.org

de @v13.dialup.peg.apc.org :

Great Page, but I'm after information on heiroglyphics found in Australia. There is a major find yet to be disclosed that I have seen. I am in contact with some geoloigists that I met on site.I have been communicating with Karine Lemon from France . If you wish to know more, email me, I can send full drawings of the heiroglyphs. MANY THANKS

de @ensisun.imag.fr :

Peut mieux faire

de @howe.pr.wku.edu :

thank you! margaret.curtis@wku.edu

de @www-c8.proxy.aol.com :

You page is great - SURF THE NET!

de @lans243.dial.voyager.net :

THIS IS COOL THANK, YOU FOR THE NAMES

de @lucille.upc.es :

Muchas gracias por esta pagina de lujo. Voy a mandar esto a mi novia que estara encantada... Mientras tanto estoy perdiendo tiempo jugando MERCI INFINIMENT L'ALDOL Dav

de @ns.mh.nl :

This is so cool. I immediatly saved a bookmark for this. It's a great gift for friends. Thank a million Arne mlz@mh.nl

de @async2a7.chatham.ciaccess.com :

ankh ankh an mitk. baah pu neter. baah pu heh.tette heh sep sen.

de @line115.megatoon.com :

continue mon brave

de @205.216.15.91 :

He aha palapala "cool" --Kameaha`aweokaponia

de @cyber164.paris.imaginet.fr :

Merci grand Amenophis pour ton voyage vers les pyramides....

de @ip187.z03.glo.be :

Nice work !!! From : Govaerts Leo, Antwerp , Belgium spetter@glo.be

de @129.63.82.3 :

j'aime tu HomePage...j'habite au Massachusetts. :) <a href="http://www.musenet.org/~angela">ma page.</a>

de @129.63.82.3 :

j'aime tu HomePage...j'habite au Massachusetts. :) <a href="http://www.musenet.org/~angela">ma page.</a>

de @8-57.client.gnn.com :

I have written to you before and have enjoyed your site. I spend a great deal of time in french speaking countries and wonder if you would like to have a link via my site in the USA. I can be found at http://members.gnn.com/HiyaKev with my best wishes... Kevin Anderson

de @205.210.138.84 :

Hey! I put in two different names and they both came back with the same symbols. What gives?

de @www-f8.proxy.aol.com :

HOW CAN I GET A COPY OF THE SOFTWARE THAT CONTAIN THE FONTS SO I CAN CREATE GRAPHICS, REPRODUCE THE HEIROGLYPHICS, LETTERS TO SEND TO MY FRIENDS.

de @ias_ppp0105.iamerica.net :

what is a side portrait of a death mask and a fan mean kenman@iamerica.net

de @204.188.44.129 :

THIS IS GREAT! INEVER THOUGHT SOMEONE WOULD MAKE A "GRAFFITI WALL " ON EGYPT

de @dialup120-6-14.swipnet.se :

Ca va? Did you know that the name of the Great pyramid at Giza is "Cheops dominates the horizon!" Says it all, doesn't it? (Men Thoth har den hemliga kunskapen.) Multilingual thanks and wishes of luck and fortune!

de @133.246.15.11 :

nuria

de @133.246.15.11 :

rosa

de @portal-02-16.ap.net :

GREAT

de @remote93.compusmart.ab.ca :

I like your page. thanks for posting the url on alt.archaeology news group. I'm going to have to Come back. to see it all JDC threecs@compusmart.ab.ca

de @161.130.138.99 :

THIS IS WONDERFUL!! ALWAYS LOOKING FOR SOMETHING INTERESTING TO DO WITH ANCIENT EGYPT!!

de @ppp38b.anet-dfw.com :

although i typed two seperate names (brodus caffall) and (tre) i recieved the exact same cartouche why is this?

de @ppp38b.anet-dfw.com :

never mind i see the error i have made thank you the same TRE

de @38.245.249.11 :

Good, thank you

de @pax-ca5-24.ix.netcom.com :

what the hell am I commenting on?

de @cormoran.lannion.cnet.fr :

gkh

de @194.22.56.252 :

I'm Estelle,live in Luxembourg,Europe and I'm very interested in everything about the modern and ancient Egypt. Thank you for these pages!Bye bye, El salama

de @bjesomar.srce.hr :

da je demokracija, bio bi VARTEKS a ne kroacija Sorry, but a little localpatriotism

de @152.163.193.11 :

Do you think that the Spynk is really weathered by wind or rain?

de @r04p07.ppp.matrix.com.br :

eu quero aprender a escrever hieroglifos

de @r04p07.ppp.matrix.com.br :

O Egito é fascinante, sua cultura, história é sem duvida uma "dadiva" para nós, muito maior que o nilo para eles.(sasilva@matrix.com.br - Brasil, Florianópolis/SC )

de @i3107opn.atl.hp.com :

I loved fining out my name in hieroglyphic but you should add a page so people can figure out the phonetic spelling of their name if they don't know it.

de @i3107opn.atl.hp.com :

I loved fining out my name in hieroglyphic but you should add a page so people can figure out the phonetic spelling of their name if they don't know it.

de @jclaude.hiawatha.fr :

c'est grace a la "pub" sur McM hier soir que j'ai cherché sur Excite. votre site apparait en premier, BRAVO pour le nom en copte. sur les autres moteurs de recherche tel Lycos, pas trouvé !! Jean-Claude d'Antibes

de @khety.iut.univ-paris8.fr :

(du maitre des lieux) C'est quoi cette pub sur MCM ? quelqu'un peut m'en dire plus

de @ngar465.cpa.state.tx.us :

Great Page

de @isufw1.tafensw.edu.au :

Ganesha Lives

de @137.197.237.19 :

AMBER WAS HERE * THE GRAFFITI WALL KICKS BUTT!

de @den-co24-02.ix.netcom.com :

Hey your home page is really cool especially the hieroglypics one where you get to see whar name looks like. But I hope in the future you get to print them out or if you sell a book where you can see all the letters and pictures. Thank you

de @den-co24-02.ix.netcom.com :

Hey your home page is really cool especially the hieroglypics one where you get to see whar name looks like. I have been studiny ancient Egypt for 7 out of the 16 years of my life and I have been wondering how my name looks. Thank you

de @pm1-72.accesscom.com :

MABES ONE

de @ppp15.pandore.qc.ca :

Bonjour,je suis contente de voir qu'il y a quelqu'un qui s'intéresse à l'égyptologie,comme moi.Si vous êtes intéresser à échanger des connaissances à ce sujet contacter moi et nous en parlerons.Et encore BRAVO!!! Képhren

de @ppp17.pandore.qc.ca :

Félicitation!!!!!!!! Mélanie B.

de @lon5-34.ukonline.co.uk :

Bonjour et merci. Tres enjoyable.

de @130.184.140.36 :

I think that your page on Hieroglyphics is wonderful. It gives the viewer a better understanding of the ancient Egyptian language and is completely fascinating!

de @206.231.148.10 :

thankyou from maggien@ime.net in york beach maine

de @200.20.180.200 :

Fantastique! Bravo!! Merci beaucoup. lsoledad@cmrj1.cmrj.gov.br Bresil

de @207.0.116.141 :

Hi, my name is Avon. I have been looking for a classic site for some time now. I have only just discovered your site and i think it's really great. I especiall love the hieroglyphics section. I have always felt that there is something awesome and romantic about hieroglyphics. Plus, I am learning some French, too. You did a beautiful job. Merci beaucoup!!!

de @adele.ens-cachan.fr :

doashcrwaebtnglvknufvw sdgfuvhzfx lfdyiorvhiurvh isurvh siudvhirh bverfvhvo8rhvi vp[o \xewcfk[erugweirgeuhvglwrysfgw8ek7fjt347rbgt8237t4h2n74tnfh8mf87ewuydguibyb cb eytfodrgmirumweruwy,uerygwvuygwgrtygortgfrtcgpowuigt efcj,erguwoitymoivruogrdgserfodrmgsvdfsyrfvsyrvsivsgucvrgmvosihtw gwvgvwmrygwmkrmgwrygcrtgmvptgvt,wgtmrtgportw rfuweo

de @adele.ens-cachan.fr :

doashcrwaebtnglvknufvw sdgfuvhzfx lfdyiorvhiurvh isurvh siudvhirh bverfvhvo8rhvi vp[o \xewcfk[erugweirgeuhvglwrysfgw8ek7fjt347rbgt8237t4h2n74tnfh8mf87ewuydguibyb cb eytfodrgmirumweruwy,uerygwvuygwgrtygortgfrtcgpowuigt efcj,erguwoitymoivruogrdgserfodrmgsvdfsyrfvsyrvsivsgucvrgmvosihtw gwvgvwmrygwmkrmgwrygcrtgmvptgvt,wgtmrtgportw rfuweo

de @138.112.194.138 :

May Horus guard you and keep you safe

de @dialinhostr053.unicall.be :

@ manu

de @167.91.60.12 :

thanks for this wonderful resource

de @bacon.gmu.edu :

Keep the server less busy we want to see our names in hieroglyphics

de @bacon.gmu.edu :

your home page is somewhat stupid, no matter what name we entered, it all looked the same! For some reason I don't think you know what you're talking about!!!

de @kkrueger.northome.k12.mn.us :

This is one of the finest educational sites on the net. You are saints. Thank you. Merci. Danke. Gracias.

de @www-f7.proxy.aol.com :

Great site for the beginner in hieroglyphics! Keep up the good work.

de @dlp109.center.eri.net :

Hi! This is a wonderful page! My history students really enjoy seeing their names in hieroglyphics. Thank you very much for making this possible (for 140 American 14-year-olds. Lee Allen Risley Dayton, Ohio USA (lriz@erinet.com)

de @205.233.146.14 :

Bonjour, je suis tres ennuyeuse maintenant, parce que je fait mes devoirs de francais et allemand, et j'ai trouve le meilleur site dans le WWW. merci bien les ordinateurs pour s'amuser les pauvres et isoles Canadiens!

de @andes.reuna.cl :

your site is very cool

de @ailps66.uab.es :

je ne sais pas parle anglais. J'aime plus le franÇais

de @yandr-bh.yr.com :

whats my name? Jeanice Brad

de @yandr-bh.yr.com :

whats my name? Jeanice Brad

de @yandr-bh.yr.com :

whats my name? Jeanice Brad

de @yandr-bh.yr.com :

This is so cool!

de @auks.inria.fr :

Euh... et pour traduire mon nom en hiéroglyphes en mon nom en français?? :D

de @144.175.4.15 :

what an interesting homepage. I found it will researching for a paper. too bad there is not more like it on the www.

de @www-b6.proxy.aol.com :

C'est chouette! Way cool! Merci bien! I feel like a true goddess now ;)

de @desire.cc.ruu.nl :

Ce programme m'a donné l'impression d'être construé très primitivement par un esprit enfantile.

de @ind-005-236-196.iquest.net :

Good Luwith the construction! I have enjoyed the Egyptian pages so far. Thanks!

de @fysi.fyg.utu.fi :

This is a freat great web site Talal

de @vie-va13-14.ix.netcom.com :

You page was just what I was looking for for my report on hieroglyphics. Thanks so much for the amazing detail! alex Harkins1@ix.netcom.com

de @199.104.214.92 :

Hi! my name is Katie Cameron, and my Social Studies teacher is teaching a 5 week lesson on egypt and She told us about this totally cool site.

de @i446.oro.net :

I am graduating high school soon and this page has really helped me decide whether or not to study Egyptology as a major, I believe I will. Thanks, Michelle Pasciuti

de @naih1p21.nai.net :

I am looking for a resource to get the meanings of different egyptian heiroglyphics. If you have any ideas please email me at MoeLarryCu@aol.com Thanks Mark

de @naih1p21.nai.net :

I am looking for a resource to get the meanings of different egyptian heiroglyphics. If you have any ideas please email me at MoeLarryCu@aol.com Thanks Mark

de @port24.superaje.com :

We think that this is totally cool! I will contact my people and get back To you ...

de @port24.superaje.com :

We think that this is totally cool! I will contact my people and get back To you ...

de @cust95.max26.new-york.ny.ms.uu.net :

Tres super! J'aime beaucoup ta page.

de @sgilliam.mnsinc.com :

Merci, thank you very much for this informative page and for the ability to do the name translation. Shelly (age 10) is doing a school project on Ancient Egypt and this has enriched it tremendously. With best regards from Sumerduck, Virginia, US, Sue and Shelly Gilliam

de @dialup106-3-13.swipnet.se :

I would like to know what the eye in the antic egypt stand for Please write me. my E-mail is: mj14167@janus.swipnet.se Anna

de @194.154.231.6 :

chod do riti

de @user-37kb7md.dialup.mindspring.com :

Hello,my name is Suzanne,and I have always been interested in Archeology.I found this sight very interesting and I would love to learn more about Heiroglyphs. I am 18 yrs. old and I,m going to start college in January,and maybe I can learn more about Egypt and it's past! Anyways I just wanted to let you know that I appreciate being to see how some words look in heiroglyphics!

de @user-37kb7md.dialup.mindspring.com :

Hello, my name is Suzanne,andI have always been interested in Archeology.I have always wondered how certain words looked in Heiroglyphs. I have enjoyed this sight very much! I am 18 yrs. old and will start college in January. I hope to learn more about egypt and its past! Anyways I just wanted to let you know how much I have enjoyed myself.

de @lp1-43.utech.net :

bound is the bomb Krew!!!

de @lp1-43.utech.net :

Breakers out under new demands.bound.out of Lompoc!!!!

de @73.chicago-3.il.dial-access.att.net :

Hi, nice site. thanks

de @164.106.127.154 :

graff is the real art for everyone with balls one love in RICHMOND---F-CK po-po and all their bullSH-T street teams...HOW 'BOUT THEM "RICHMOND" KIDS, they be SMASHING, every shape, form, and fashion...c.k.u.

de @user-168-121-163-43.dialup.mindspring.com :

Bonjour! Je m'appelle Mandi. J'ai quinze ans et j'aime votre page... In other words: YOU ROCK, monsieur!

de @www-l6.proxy.aol.com :

Egypt rules. Hyroglyphics are cool.

de @www-r6.proxy.aol.com :

Egypt rules. Hyroglyphics are cool.

de @145.81.64.69 :

i dont know why all these mesages are about hierogliphikkks, all i wanted to see was some hi impact graffiti, some kids just bombing innercities, tearing whole settelments a part. Or growing from vandalists to well paid artists. And what do i get??? Nuttin!!!!!!!! well any way thanks for lettin me put my tu censt in! PEACE!! BEAU MEGA

de @max1-wc-ca-32.earthlink.net :

i'm wondering if you know how the coptic language came about?

de @206.129.216.88 :

Thank you for this info.I'm very excited to begin learning. I have already put this page on my "favorites" list. TONYA IN PORTLAND, OREGON, USA

de @206.129.216.88 :

Thank you for this info.I'm very excited to begin learning. I have already put this page on my "favorites" list. TONYA IN PORTLAND, OREGON, USA tjaquino@inetarena.com

de @206.129.216.88 :

Thank you for this info.I'm very excited to begin learning. I have already put this page on my "favorites" list. TONYA IN PORTLAND, OREGON, USA tjaquino@inetarena.com

de @206.129.216.88 :

Thank you for this info.I'm very excited to begin learning. I have already put this page on my "favorites" list. TONYA IN PORTLAND, OREGON, USA tjaquino@inetarena.com

de @206.129.216.88 :

Thank you for this info.I'm very excited to begin learning. I have already put this page on my "favorites" list. TONYA IN PORTLAND, OREGON, USA tjaquino@inetarena.com

de @206.129.216.88 :

Thank you for this info.I'm very excited to begin learning. I have already put this page on my "favorites" list. TONYA IN PORTLAND, OREGON, USA tjaquino@inetarena.com

de @206.129.216.88 :

Thank you for this info.I'm very excited to begin learning. I have already put this page on my "favorites" list. TONYA IN PORTLAND, OREGON, USA tjaquino@inetarena.com

de @206.129.216.88 :

Thank you for this info.I'm very excited to begin learning. I have already put this page on my "favorites" list. TONYA IN PORTLAND, OREGON, USA tjaquino@inetarena.com

de @163.121.163.43 :

Bonjour ! Je suis en Egypte depuis 8 mois pour le boulot, et il faut que ce soit sur le Net et de nuit que je decouvre ce pays ! Ceci dit, vous pouvez vous attribuer le cartouche "pile-poil" pour votre serveur parce c'est ce qui se rapproche le mieux de ma philosophie (hem !) du Net : des infos, de l'humour, et moins de 500K a charger a chaque page ! Je reviendrai vous visiter, et a plusieurs ! Merci ! Michel Bordry (m.bordry@egegp.bull.fr, si ca vous chante...)

de @207.113.233.39 :

de duford@lifac:

de @d1p21.ams.com.br :

Congratulations from Brazil! Salutacions du Brésil! Parabéns do Brasil! Excellent page!!

de @cust44.max6.new-orleans.la.ms.uu.net :

;lasut

de @computer210.esdal.org :

Why is the language Meduntr not metioned?

de @gf-dialup-18.global2000.net :

I think that this is a nice site

de @gf-dialup-18.global2000.net :

Thank you for all the info. My name is NICHOLAS QUINN. You can e-mail me at chiefone@global2000.net

de @courier05.jungling.net :

Bonjour. Je suis un american. Je suis tres fous! J'ai une peche. J'adore ma chien, TIllie. Salut!

de @courier06.jungling.net :

Bonjour. J'habite dans Whitefish Bay, WI. Dans America. J'adore egypte. Dans l'histoire de monde, vous etudiez egypte i l ya une mois. Je parle un peu francaise. Je suis nul dans francaise. Je ne sais pas pourquoi. J'esperance mon francaise et bon pour toi. J'adore Star Trek et Stargate. Cette bonne film! Ecrivez moi @ MLindeusamail.net Merci pour cette page! Parlez-vous anglaise? Ecrivez moi dans francais et anglaise. Je besoin devenir en francais. Au revoir. P.S-Je m'appelle Mulder. Salut.

de @ppp-8.dux.ru :

Your page is beautiful! :-@) !! That is my second sleepless night in Internet. I has buy a computer to will be connect with Net and find peoples who love Egypt like I. Kmt t3 n ib-i! No, Kmt t3 n ibw-nw! Ankh- ud- seneb for you, your Tetyankhet (Tatiana Matveeva from Saint-Petersburg, ppinity@dux.ru )

de @courier04.jungling.net :

Bonjour. Dans ma francais nul, j'ai ici! Ca va? Moi, je suis tres bien, merci. J'adore cette page parce que mon email ne travail pas. Mon dieu preferee est Anubis. Comment vous appelez-vous? Je m'appelle Christiane dans mon class de francais. Je suis american. J'ai 14 heures, et j'adore l'egypte. Ecrivez moi, quelqu'un! Au revoir. Christiane

de @port15.cjnetworks.com :

Help: no matter how often I try to get my name in hieroglyphics, the server is always reported busy. Is there a problem? Sara Tucker zztuck@acc.wuacc.edu

de @user14.dcscomp.com.au :

FOR EVERY ONE,THERE IS A FIRST TIME. THANK YOU .

de @ppp-24.dux.ru :

Ankh-wd-seneb! My third day with Internet and with you in my favorites... Pretty web page! Friends! Who love Egypt and Egypt-sites in WWW! I wait your messages - please! Egypt is a country of my heart... I speak englisch, hablo espanol, dico latine and dd-y rc n Kmt /little... :-)/ Tetyankhet - Tatiana Matveeva from Russia (ppinity@dux.ru) and Dy-ankh-my-Re-dt (Diana...)

de @205.210.137.21 :

THIS IS A BIG YELL OUT TO NYC AND TO THE FTC CREW!.YOU'Z BE KICKEN IT!

de @159.237.6.31 :

Ha sido muy bonito

de @ppp-206-170-170-207.scrm01.pacbell.net :

I have lost my heart and is to Egypt! apis@pacbell.net

de @149.123.191.104 :

Graffiti is the bomb

de @ppp-15.dux.ru :

St tn nfrnfrw on the Web! And Graffiti Wall is for me like White Wall of Memphis! ;-) Serge, ht nbt nfr wcb for you. Tetyankhet true of voice, simply fan-of-Egypt. (my Email in PgUp, messages welcomed).

de @ppp19.negia.net :

Great!!!

de @cache1.cc.interlog.com :

I am interested in the following words being translated to hyroglyphics. DEKOTA ASHLEY My email is annmarie@interlog.com I would greatly appreciate any assistance.

de @146.9.104.172 :

Bravo....C'est tres bon de trouves quelqun qui est iteresse a les Heirogliphique. Moi meme, Je suis un Egyptien et J'essaye etudier les inscription Heiroglyphique, mai c'etais un traville dure et problematique

de @146.9.104.172 :

Une orange sur la table Un robe sur le tapis Et toi dans mon lit Belle present de present Fraichuere de la nuit Vit de ma vit

de @146.9.104.172 :

Thank you for your wonderful page. Egypt was always the birthplace of civilization. All the world had its ethical teachings out of the teachings of old Egyptians.From there, the sun of conscince has risen. The civilization of old Egypt was a mral one, not a mortal one. Old egyptian belief in life after death made them live a moral life, preparing for their meeting their god of the underworld, who would pay them for their earthly deeds. In Egypt began the first call to worship one unique god, Aton-the son god-, by the Pharoah Aken Aten, and he was very near to the concept of God. From there, Moses learnt the ethics of Judaism, and he established the Jewish religion on the foundations of old Egyptian teachings. If you look at the old temple of the Israelites, you will find it a copy of the Egyptian temples, an outer court, a holy, and the holy of holies. Also, the great preast in Egypt was the only one who could enter the holy of holies, a concept that was taken by the Israelites. There is a lot more of the Egyptian rites that were transferred by the Israelites to the whole world, through Judaism, and consequently through Christianity. Even in the Old Testament, Egypt was said to be a powerful country, but not an unmoral loose country, like what was said and repeated about Babylon. Read" The Dawn of conscience" by James Breasted, and there you will find out, as I did, where the dawn of conscience did REALLY rise.

de @cybootp-146.ccsn.nevada.edu :

OFA OFA OFA OFA OFA OFA OFA OFA OFA ALIE ONE

de @t700.esiea.fr :

Apopis c'est comment en Egyptien??

de @cache.infopro.spb.su :

snb.tj! Dd.jn Sms.w jqr pH.n.n t3 Internet! mr.n r3 kmt Hnc mdw nTr! We are the egyptology students from St-Petersburg University. Today we translated Sdw.k nj r3 kmt n Ttianxt Hna DianxmircDd... Our imn-Htp III from the Neva-embankment says hello to you. Natasha.wj (2 persons) Hna Ttyanxt m3a-hrw.

de @poincare.esstin.u-nancy.fr :

c'est toujours "busy"!!!!!

de @cnc048050.concentric.net :

Hell-o I think the idea of the cartouche on a computer is a good one. It is a very busy site.

de @ppp-10.namur.interpac.be :

Hélàs; trois fois hélàs ! Déception cruelle trois noms très différents donnent un résultat identiques. Soit les Egyptiens n'étaient pas très bons en orthographe, soit votre système est quelque peu moqueur ! Merci de me dire quoi...

de @rosalyn.tssc.univie.ac.at :

I stepped in just because boosting about TeX's abilities to handle slightly exotic tasks talking to a nice student of aegytology. And now it seems that i'm going to spend more time on your excellent introduction to Hieroglyphs. The TeX implementation is excellent! Merci!

de @ns.iceonline.com :

Hi! I think it is cool to see a name in heiroglyphics I just dont understand how to write my name phonetically, maybe someone could tell me? My name is SARAH and I can be emailed at sarahh@icebox.iceonline.com Anywayz! thanks, Egypt is cool, I wanna visit there sometime

de @user-168-121-110-205.dialup.mindspring.com :

This is so nice - I just ran across it looking for info on cremation - It seems to much to copy today and I don't know if it possible to transfer to a disc from here - so I will be back Betty

de @152.66.150.227 :

pharaoh

de @parrot.le.ac.uk :

I'm a little confused as to why half of this page is in french.

de @jacarepagua.rio.com.br :

Fantastic, I will put this link into my personal HomePage ! Alexandre Brügger abrugger@rio.com.br

de @courier06.jungling.net :

Bonjour. J'adore cette page! J'mappelle Laura, et j'adore egypte. Je suis americain. Au revoir.

de @adric.execpc.com :

You need to make files of the hieroglyphic translations avaliable in gif or jpg format. If they are and I didn't find out how...I suggest you make it easier to access information on how to do this. Otherwise.....thanks for the info.

de @ppp17.chickasaw.com :

Great Site! I am teaching a 6th grade unit on ancient Egypt and this site has been a tremendous resource for us. jepeever@chickasaw.com

de @proxyc.kodak.com :

Bonjour, Je m'appelle Solange Doucette. J'adore cette page. Je ne parle pas beaucoup de francais mais cette page est tres fantastique! Je suis americaine. C'est une page fantastique. J'etudie la langue d'egypte anciente. Merci beaucoup. Au revoir.

de @dialup104-5-10.swipnet.se :

Hey! Really neat to see ones name written in hieroglyphics! I will pass the word on to my friends. Ciao Carina from Sweden

de @recherche-gw :

test

de @recherche-gw :

test

de @khety :

envoi

de @pppa119.francenet.fr :

Salut Serge. Je viens de passer par ton site. Olivier Cabon. e-mail: luxmo@francenet.fr. Amitiés.

de @ms1l8.sirus.com :

" Name in Hieroglyphics " was great THANKS for putting it up :-)

de @138.77.66.20 :

I don't know whether your "Name in Heiroglyphics" was good or not because whenever i tried to use it it was bust. I'll be Back See-ya soon SASPA

de @138.77.66.20 :

I'm back and still haven't been on your program it says the server is busy later bub SASPA

de @quiddity.serv.net :

Hullo, I've yet to be able to generate a hieroglyph of my name (your server seems to be very busy), so I've looked around your other pages. Unfortunately, .gifs you call to from: http://khety.iut.univ-paris8.fr/gifs/ ... don't seem to be there, hence the error: "File Not found The requested URL /gifs/ was not found on this server." Hope this helps. --rbm

de @apolo6-a40.racsa.co.cr :

QUE DICE AQUI????? HEY MI NOMBRE EN JEROGLIFICOS NO SIRVE!!!!!!!!!

de @apolo6-a40.racsa.co.cr :

QUE DICE AQUI????? HEY MI NOMBRE EN JEROGLIFICOS NO SIRVE!!!!!!!!!

de @apolo6-a40.racsa.co.cr :

YOUR "HIEROGLYPHES" TRANSLATOR DOESN'T WORK IF YOU COULD SEND ME THE NAME "ANA VICTORIA" I WOULD REALLY APRECIATE IT FRASOTO@SOL.RACSA.CO.CR

de @roger.scs.carleton.ca :

Hmmm...I noticed that my name came up the same as my mothers...

de @titan.vision.net.au :

Tara "97"

de @titan.vision.net.au :

Tara-Lee Jarman "1997"

de @128.111.114.90 :

Blakestar

de @vr063.kirkwood.cc.ia.us :

The information was very informative. My daughter is going to love this information for her school project. Keep up the good work.

de @lpm2-2.atlcom.net :

The hieroglyphics were great!!!! I would love to hear more about Egypt and the other cool stuff about it!! Ben Maloney age (10)

de @lpm2-2.atlcom.net :

Thank you so much for the info. I got an A on my report. The info is very interesting and the Graffiti Wall is tight. If I ever need a report on this stuff, you'll be my first priority. I'll also recomend you to friends and family! Ben Maloney age (10)

de @novix.njudung.se :

A really great page! Keep up the good work and come with more info in the future. /Andreas Andersson Sweden

de @ilwww.ac.il :

This site sucks!!!

de @max2-sc-ca-36.earthlink.net :

NO MATTER WHERE YOU GO, THERE YOU ARE.

de @piweba4y-ext.prodigy.com :

j'parle un peu de francais!!

de @169.204.125.59 :

HEY whats up my name is winky and my e-mail adress is winky@ewa.net

de @violett-04.nada.kth.se :

öhhh.. The almighty wicked

de @ppp17.ren.hol.fr :

bon site à bientôt un breton amateur d'égyptologie

de @duke.georgian.net :

Totally awesome Bien

de @hd107-005.compuserve.com :

Every time I have tried the "name in hieroglyphics" server, it has been busy: toujours le serveur travaille.

de @iway035.ritsec.com.eg :

You have a very good page, could you link to our page http://www.idsc.gov.eg/tourism/tor_trn.htm

de @194.204.207.10 :

SALUT!JE VOUDRAIT SAVOIR COMMENT ON TRADUIT SON NOM EN HYROGLIFE FAIRE SUIVRE LA REPONSE SUR GRAFFITI

de @194.204.207.10 :

SALUT!JE VOUDRAIT SAVOIR COMMENT ON TRADUIT SON NOM EN HYROGLIFE FAIRE SUIVRE LA REPONSE SUR GRAFFITI

de @194.204.207.10 :

ESSAIS

de @palm00-26.ca.qnet.com :

My daughter had a project on Egypt to do & your site helped. Thank you !!! Your Cyberdog http://www.av.qnet.com/~cyberdog/

de @206.193.0.125 :

EST-CE QUE VOUS SAVOIR DES NOMS PAR LIZ?

de @isdn-38.niagara.com :

This was a really great web site! I especially enjoyed seeing my name in hieroglyphics in a cartouche! By the way, do you know anything about Pan-Horus? I've heard of Horus, but what about Pan-Horus?

de @hrfr03-sh3-port143.snet.net :

we are in the sixth grade we are learning about ancint Egypt thank you for almost helping us

de @nlightn-ppp-8.nlightn.com :

This site is the bomb!!!!!!!!!!!!

de @max1-02.nice.iway.fr :

De RAph@vinie@worldnet.fr L'egypte ma deuxiemme patrie.... Merci pour ce site Fabuleux Peut etre un peu len tpour les traductions en hierogliphes

de @ip116034.keycomm.it :

vezzaro domenico

de @c030.waldonet.net.mt :

my name is nigel. i am 7 years old. i liked yoyr page very much. my school project was about egyptians. i tried to look at your photos but they took too long. nigel

de @ppp-206-171-248-40.vntrcs.pacbell.net :

Your hieroglyphs info was great! You saved my report.

de @173.new-york-005.ny.dial-access.att.net :

KEEP GOING

de @206.3.193.20 :

Hi, I'm a graduate student, working on a term paper on Hieroglyphics for my History of western arts class. I think this web site is really good.I will need some information here for my research, hope it's okay with you. Of course I will include your name in the bibliography. Merci bien , Olumide Sowunmi(osowunmi@scad.edu)

de @r8a16.impsat1.com :

This is very interesting. Thank you very much. Laura

de @user-168-121-62-218.dialup.mindspring.com :

This is really cool!!!

de @205.233.146.155 :

I am greatly interested in Ancient Egypt and I am considering a career in Egyptology. I want to know if there are jobs available in this field. What kind of competition for jobs are out there? Thank you!

de @fep4-orange.clear.net.nz :

A most interesting web page on Egypt. Thanks for the bi-lingual approach.

de @chk0119.tvs.net :

Serge old man: I am a college student from Canada who has taken the semester off to travel. With little else to do, I have taken it upon myself to learn the rudiments of ancient Egyptian. Your site has proved to be of significant benfit. synapse@uniserve.com

de @jau.eb.ufmg.br :

I am from Brazil and this page was very usefull for me . Thank you very much!!! Mara

de @chene.wanadoo.fr :

Bravo pour l'originalitŽ de ce site (En franais ce qui ne gache rien) vive la bretagne

de @pc130.cis.vutbr.cz :

Pavel Crhounek

de @piweba6y-ext.prodigy.com :

I enjoyed your scholarly work. Thank you for the splendin work. (this remark is written left to right and is best read in the same order). (a small joke) H. L. Alderson - Varykeno Farm - Washoe Valley, Nevada U.S.A. KRXT42A@Prodigy.com

de @piweba6y-ext.prodigy.com :

I enjoyed your scholarly work. Thank you for the splendid work. (this remark is written left to right and is best read in the same order). (a small joke) H. L. Alderson - Varykeno Farm - Washoe Valley, Nevada U.S.A. KRXT42A@Prodigy.com

de @piweba6y-ext.prodigy.com :

I enjoyed your scholarly work. Thank you for the splendin work. (this remark is written left to right and is best read in the same order). (a small joke) H. L. Alderson - Varykeno Farm - Washoe Valley, Nevada U.S.A. KRXT42A@Prodigy.com

de @www-ax3.proxy.aol.com :

is there a section devoted soley to hieroglyphics? I am studying them now and was curious!!!

de @www-ax3.proxy.aol.com :

Hi, I really enjoyed this site. it was very educational and yet.....fun! Keep up the wonderful work! -Oxford, ohio

de @194.17.228.163 :

This was very funny, seeing your name in hieroglyhs.

de @194.17.228.163 :

love and peace to egypt from anna

de @media.dcav.u-bordeaux2.fr :

ETUDE DE L'EGYPTE ANCIENNE

de @g61-131.citenet.net :

You may be interested in a program called HiroWriter. You can see a sample at www.shulamit.com thank you

de @206.5.98.33 :

Dear Sir, This is a wonderful site. I have been interested in ancient egypt since childhood. I have never acted upon this. We are opening a tanning salon and decided to decorate in an egyptian motif. I also chose to use an egyptian hieroglph as a logo. I chose the hieroglyph for sun. I have added this page to my bookmarks and hope to do extensive reaserch on the ancient egyptian language if our business does well and time allows. Sincerely, Christine Andrea Kazoun

de @media.dcav.u-bordeaux2.fr :

Jean Pierre

de @media.dcav.u-bordeaux2.fr :

Jean Pierre

de @media.dcav.u-bordeaux2.fr :

JEAN PIERRE

de @pc4.pfi.uni-leipzig.de :

Dudi

de @pc129.cis.vutbr.cz :

Paul

de @194.224.54.234 :

mgf00006@teleline.es : I'm from Spain. Thank you for your pleasant and interesting information.

de @sentinel.exeter.edu :

charlotte

de @d00120.mco.bellsouth.net :

aday is a dork!

de @gioconda.cibercafe.pt :

my sincery congratulations for the responsable for this page. the culture of ancient egipte is so distance but so importannt in the reflex of our culture. i'm portuguese and my culture origins is of some civilizatons barabarians in Europe and the most important was the romanic. but it's important think, if we think that we can't identify directment others cultures with us, it's so important think that problably that indirectment it can be possible. and if nothing has in commum, it's very very important see others origins to open our mint to a big universal knowledge. i'd like to understand the hieroglific language, and if somebody can help me, i thanks a lot, and promess that i'm disponible to help for other chooses. my e mail is : cantadam@cibercafe.pt

de @207.23.20.62 :

I THINK THAT IT IS VERY COOL THAT SOME ONE MADE A PAGE FOR ANCIENT EGYPT, I AM A 15 YR. OLD STUDENT AT RIVERSIDE SECONDARY SCHOOL IN BC CANADA MY TEACHER SAID THAT THERE WOULDN'T BE A PAGE ON ANCIENT EGYPT BUT I SAID THAT THERE WOULD. I TOLD MY TEACHER THAT YOU CAN FIND ANYTHING ON THE INTERNET AND I WAS RIGHT AND HE WAS WRONG.

de @port9.ts1.westnet.com :

SHAWNA WUZ HERE

de @nice-gateway.nice.com :

alon alfa

de @sebaty :

Serge je te salue un etudiant qui t'adore

de @206.50.21.234 :

J'AHITE AU TEXAS AUSSI, ET C'EST MOCHE! ET J'ADORE L'EGYPTE! VIVE LE CANADA! RACHEL D.

de @cybootp-98.ccsn.nevada.edu :

out for action krew!!!!!!! Las Vegas

de @user-37kb7ff.dialup.mindspring.com :

My name is Ryan

de @mail.arcc.org :

The Graffiti Wall is cool

de @te189.swisstelecom.com :

Merci pour le travail, il saura bien aider un pré-estudiant en egyptologie

de @secoia.linkway.com.br :

talita trivelato

de @as1.pubnet.sk :

serem na to!

de @131.211.28.157 :

This is great encroyable (is that good french?) Keep up the good work :)

de @pd01-230.par.compuserve.com :

servane je t'aime. geoffroy

de @luv15pub133.bluewin.ch :

I'm so happy to have find this page. Thank you!! Monika,switzerland

de @mac51.tsc101.usu.edu :

It was a neat Birthday gift I got...my name written in hieroglyph using your Homepage. Thanks a lot...great Job... way to go Univ-paris8 :) from Utah USA

de @ppp025.3.mtimi.videotron.net :

je suis de chicoutimi au quebec et j`adore l'égypte felicitation tres beau travail

de @diana.cps.unizar.es :

que pacha pepeeeeeeeeee

de @af-19.kvadraturen.vgs.no :

HEI JEG HETER EIRIK

de @rg-g17.access.net.il :

Hello, it's wery nice to meet so an interesting site, and I thing that Yow are duing a great job ! I wass in Egipt a few times (as a civilian and also millitary) but I never believed that "Hierogliph's" are suitable even for our names ! CHAPOO ! oreste@mail.inter.net.il

de @ww-tf43.proxy.aol.com :

I am going to Egypt in July, so I am reading your pages to be informed.

de @ppp202.219.mtimi.videotron.net :

mon nom est Johanne et je suis de Chicoutimi au Quebec ( Canada) c'est la deuxieme fois que je visite ton site et ce n'est pas la derniere je le trouve tres interessant je reviendrai surement le consulter une prochaine fois felicitation

de @fw.itu.ch :

Bonjour. Je m'appelle Yossi Amar Je doit fair un devoir de Geo sur l'Egypte. Si vous pouvez m'aider contactez moi pa courier electronic: family.amar2@itu.ch Merci.

de @170-229-162.ipt.aol.com :

Pour Cécile. J'espère que tu as aimé l'Ecriture de l'Ancienne Egypte. Je t'embrasse. Ton Papa

de @170-229-162.ipt.aol.com :

Pour Cécile. J'espère que tu as aimé l'Ecriture de l'Ancienne Egypte. Je t'embrasse. Ton Papa

de @143.107.194.215 :

Lenise

de @205.151.162.9 :

je trouve cela captivant de pouvoir savoir son nom en hieroglyphe. moi et mes amies allont faire une recherche sur l'egypte et nous apprecions beaucoup les informations. MERCI votre amie Valerie ro

de @200.33.144.176 :

PATTY

de @pm9-s21.colba.net :

votre page est excellante je capote vraiment bonne chance et continué comme ca bye bye

de @37-dialup.internet.ve :

essai

de @ppp54.anet-stl.com :

GREAT SITE!!! Especially the Hieroglyphic name translator! =)

de @ww-tj23.proxy.aol.com :

c'est intéressant continuer champollion doit etre fier de vous demanez@aol.com

de @ts001d09.sea-wa.concentric.net :

This is great! Thanks for the .gif of my name.

de @slip139-92-62-124.lau.ch.ibm.net :

est-il possible d'avoir une police de caractères pour l'imprimante ? Grosse bise.

de @n182-062.nclack.k12.or.us :

dddddddvggdddghmj

de @207.24.69.4 :

I like your page! It's great! Alejandro Carbonara (age 5) ps. my father helped me write this

de @ts1-20.f108.quebectel.com :

Salut, je m'appelle Renée, l'Egypte ancienne est ce que je préfère dans l'histoire de l'humanité. Ma déesse favorite est Bastet car j'adore les chats et qu'elle est réputée pour ses talents de guérisseuse. J'aime à penser qu'elle est mon ange gardien. Salut!

de @ppp30-annex1.hgea.org :

what i see so far you are doing a real good job.

de @ppp2-98.nova.es :

collons que fret que fa

de @suncorreio.correionet.com.br :

mauro

de @ppp-annex-0231.que.total.net :

salut les hommes et les femmes

de @proxy4.emirates.net.ae :

You are doing a great job by having a page for Heiroglyphics on Internet.

de @proxy4.emirates.net.ae :

You are doing a great job by having a page for Heiroglyphics on Internet.

de @ppp161.92.redestb.es :

elizabet

de @nexus.mlckew.edu.au :

Cool!

de @nexus.mlckew.edu.au :

Hy. mi naym iz Kayt. i lyk gods and Egypt. if yoo rite to me, id lyk it. from Kayt. ps i lyk this payg

de @nexus.mlckew.edu.au :

Hy. mi naym iz Kayt. i lyk gods and Egypt. if yoo rite to me, id lyk it. from Kayt. ps i lyk this payg

de @gbc.gbrownc.on.ca :

The quick brown fox jumped over the lazy dog

de @195.113.28.72 :

Je mi 7 let bydlim v praze zajimam se o Egyptologii a moc se mi libi vase stranka Marketa PODOLSKA

de @pm-015.qbc.clic.net :

salut comment avoir acces a ton traducteur

de @p58.t0.rio.com :

I am in search of images of the Egyptian mythological bird, the phoenix. Also wish to know the relationship between the phoenix and the griffin of Greek myth.Thank you.

de @kel-as-02a15.direct.ca :

belle page

de @203.249.84.202 :

when I have found this page, I couldn't go to bed but...... now I know must have a big job...MONEY!!! MONEY!!! MONEY!!! is arcaeology rich man's exclusive possession? ...... -from SOUTH KOREA- Yong Tae, Lee. dreamer@shinan.hongik.ac.kr

de @wheel110.watstar.uwaterloo.ca :

Tres impressionne avec le cgi nom-en-glyphes... mais je viens d'observer que quelques glyphes varient avec position dans un nom. (La glyphe pour 's', pour example, est une chose si elle commence le nom et quelquechose different a la fin.) Pourras-tu installer ici une page avec une liste simple de glyphes et leurs equivalents anglaises? C'-a'-d, un alphabet? (Notant, naturellement, ces variations-avec-position.) -- Apart de cela, c'est une fantastique page! -- nykwit@nightly.com

de @gbc.gbrownc.on.ca :

site

de @dm2.uibk.ac.at :

Exactement ce-qui me manquait dans ma collection de mon nom ecrit en langues exotiques !!!

de @ligne4.ac-idf.jussieu.fr :

pour les hiero. n'arrivent-ils pas sous forme de fichiers images ?

de @romfs7.rom.on.ca :

So you assume the reader is a 'he'? (Ref to Introduction under construction)

de @nez101.neteze.com :

GFLJHGLKJHGLKJHK;U

de @204.198.84.221 :

this is a great web site

de @204.198.84.221 :

my name is florenia

de @204.198.84.221 :

did you get the notes yet

de @204.198.84.221 :

de @ kursus 5.natmas.min.dk

de @user-2k7i1hs.dialup.mindspring.com :

RollnRebel waz here. This Egyption stuff is cool......

de @206.156.242.71 :

Vermilon's World Order Mafia

de @har-tx3-24.ix.netcom.com :

FROM: TEX THIS PAGE RULES

de @revelation.unomaha.edu :

when will it be ready

de @dialup16.bcinternet.com :

J'aime votre page beaucoup. Bien Fait!! Bernadette Hallock Kelowna, B.C. La Terre est votre Mere

de @spitech.com :

People live, they suffer, they die. Only one thing outlasts them and that is LOVE!!!

de @205.189.176.203 :

Dear Science Center ,dudes we loved your hiroglifics "names" It was tottaly awesome that we can see and translate our names or phrases to egypcian.... I am a big fan of egyptian artifacts and have a question .."how come people dont get mumafied any more" and if they wanted to could they . lover of egypt.

de @manny.bonus.com :

Shoobi doobi doo

de @hydra.chru-lille.fr :

Salut, c'est la 2ème fois que je viens sur ton site et je le trouve très sympa. L'égypte, c'est ma 2ème passion et je retrouve mon compte quand je viens te voir. Alors à bientôt. Jeanluc de Lille en France

de @proxy1.eunet.be :

Moi aussi je suis passionnée d'Egypte et moi aussi j'ai trouvé cette page super intéressante...Kate

de @wt-d4-206.wt.net :

Terrific work! I am using your page to help me create an interesting unit for my 6th grade class. I want to give them some simple texts to translate (or make guesses about). Thanks so much!!! Debbie Shaddix Porter, Texas (Near Houston)

de @159.149.30.44 :

a b c

de @pm104-95.promedia.net :

"Some scholars argued that nothing could be invented twice, & others, like Elliot Smith, proposed that all post Stone-Age discoveries and inventions came from Ancient Egypt. "This Egyptocentric hyperdiffusionist dogma is no longer fashionable." excerpt from Grolier Encyclopedia It may no longer be fashionable, but it's stylishly true. High 'D' & Breece F. breecef@softcom.net

de @leig30.amc.uva.nl :

just like an othe Egypt lover I imediately tried ZAZA It does work! The books do`nt mention the letter E, where did you get it? good luck with your page!

de @247.st-antonio-001.ca.dial-access.att.net :

I think science RULES

de @247.st-antonio-001.ca.dial-access.att.net :

I think science RULES

de @proxy3.ykt.prodigy.net :

I love your page! I could spend hours with it!

de @143.235.46.178 :

Great site!!! has even got me more excited about Ancient Egypt. Bob, Wisconsin, U.S.A.

de @pppa091.linkonline.net :

Marisa

de @pppa091.linkonline.net :

why do people take people for advantage???

de @pppa091.linkonline.net :

i think sex is to much of a conversation

de @194.199.34.53 :

bien surtout le nom

de @tbdpc1.ugrad.abdn.ac.uk :

Excelent!

de @macip219o-foe.bvsd.k12.co.us :

Hi Mom this is Nicholas and I Just wanted to say hi

de @194.79.97.26 :

l'egypte c'est super

de @palrel4.hp.com :

darren

de @204.19.83.36 :

Alain Cote et son ami Stepane sont parti

de @proxy.wanadoo.fr :

Bravo! J'adore l'Egypte, et ce site est remarquable.

de @200.241.117.149 :

Historiadores da Escrita

de @web4.infonie.fr :

J'ai quelques textes en winglyph, je suis à la recherche de Texts sur le Mail

de @170.182.220.4 :

Dear Bill Nye, We like your web site because it's intresting

de @proxy.grolier.fr :

Je suis passionnée de l'Egypte et j'ai sauté sur l'occasion pour voir votre site. Il est super et j'ai appris de nouvelles choses très interessantes ici. Bonne continuation et bravo !!!

de @spencer.wm.net :

tjena

de @neptunus.tvi.is :

jon sigurdrron

de @tclux14.cec.lu :

salut c'est moi comment vas-tu mon petit ami l'égypte t'intéresse moi aussi pourais-tu me procurer des documents s'il te plait

de @013nv.tsc.k12.in.us :

I'm studying heiroglyphics in World History, and I have been wanting to see my name written in heiroglyphics. It's pretty cool. Thanks for giving me the oppurtunity. Megan a true U of F fan all the way.

de @013nv.tsc.k12.in.us :

I'm studying heiroglyphics in World History, and I have been wanting to see my name written in heiroglyphics. It's pretty cool. Thanks for giving me the oppurtunity. Megan a true U of F fan all the way.

de @brethil.esoterica.pt :

Not all of the documents in your 'hieroglyphic textes' have their hierogyphic and translation versions. Are you working on that?

de @ts027d08.sag-mi.concentric.net :

Hi.

de @bib-mac-5.ens.fr :

Bravo, et à un de ces jeudis

de @ppp20.point-net.com :

Je n'ai pas trouvé ce que je cherchais, mais ça m'a beaucoup plu!

de @151.99.132.232 :

PEEP EST VIVANT.

de @150.199.110.117 :

Hi,I am looking for a 'complete' alphabet of Egyptian heiroglyphs for my art class susan

de @library10.barstow.pvt.k12.mo.us :

Je suis un etudiant du francais et cette page a assister moi en mes devoirs. Merci.

de @tnt1user69.concom.com :

This is a wonderful site, thank you for bringing it to the internet.

de @ww-tl05.proxy.aol.com :

A great Site for Egyptian info! Beautiful Pictures and interesting facts

de @ppp43.sbbs.se :

i need som more fact about hiroglyphs there only seems to bee pictures here

de @isdn-v14e-0.remcomp.fr :

Je cherche la liste des significations des hiéroglyphes.

de @206.207.233.25 :

robert was here

de @ww-tq04.proxy.aol.com :

thank you for giving us this info i am a high school student taking w. history we are learning about ancient eygpt i need to know about this to finish my project thank

de @hccafr.hcca.ohio.gov :

Amber Lynn Paroda

de @hccafr.hcca.ohio.gov :

Jonathan is the coolest.

de @hccafr.hcca.ohio.gov :

KIM TRAN

de @hccafr.hcca.ohio.gov :

Hi my name is Bryan. I go to St. Vincent Ferrer school.

de @hccafr.hcca.ohio.gov :

Jonathan Cornette is the coolest.

de @hccafr.hcca.ohio.gov :

I think your cool.

de @hccafr.hcca.ohio.gov :

Bonjour! I don't know how to speak french

de @hccafr.hcca.ohio.gov :

Jonathan Cornette is the coolest.

de @hccafr.hcca.ohio.gov :

HOT!!!!!!!!

de @burlco-01.burlco.lib.nj.us :

WESTSIDE

de @193.44.2.4 :

david och oscar sitter här och studar

de @193.44.2.4 :

hgyuoljffyh

de @193.44.2.4 :

hgyuoljffyh

de @193.44.2.4 :

är det nån som vill chta

de @193.44.2.4 :

is it some skaters here

de @193.44.2.4 :

lars

de @193.44.2.4 :

Ille habite in france

de @193.44.2.4 :

Someone who want to chatt

de @193.44.2.4 :

erik jävel

de @193.44.2.4 :

Fina David och rasmus

de @193.44.2.4 :

WESTSIDES

de @193.44.2.4 :

var är alla bögar som hrter david och erik och rasmus böb jävlar

de @193.44.2.4 :

raze jävel är fina

de @193.44.2.4 :

fins det någon bög som heter David och Erik

de @193.44.2.4 :

rasmus ska du vara sån kan det lika järna kvitt bög jävel

de @204.48.151.249 :

Dear who it may concern, My name is Rosana Diaz. I am really interested in Ancient Egypt. I think I want to become an archelogist. Learning about Ancient Egypt. I think it is wonderful to learn about ancient mummies.

de @nrwc00-sh7-port178.snet.net :

Thanks! I am doing a report on hierolglyphs, and your page helped me!!! Thanks a million! Tom103@juno.com (amanda)

de @1cust54.max20.new-york.ny.ms.uu.net :

Serge--I very much like what you are doing and would like to discuss topics with you about Egypt, hieroglyphics, antiquity and what have you. I am currently teaching a course in Blacks in Antiquity at the College of New Rochelle in Manhattan. My textbooks are by Cheikh Anto Diop, St. Clair Drake, and Ivan Van Sertima. Are you familiar with these scholars? Let's be in touch, if it is possible for further, more detailed conversations since I am a veritable neophyte when it comes to your expertise. Herb

de @cache1.cc.interlog.com :

i have a question about a hieroglyph that i cant find on this site. it looks like a circle with three dots in a line inside the circle. if you have seen or know what im talking about e-mail me and explain what that sign means. my e-mail adresse is barr@interlog.com thank you

de @gr-max6-86.iserv.net :

hi

de @207.96.181.212 :

Merci pour les images. J`en avais de besoin pour un projet en francais. Karen

de @ww-tj66.proxy.aol.com :

Hurry, Hurry We Wait!

de @dfw67210.gte.net :

www.auctionstop.com

de @195.60.138.3 :

ciao

de @195.60.138.3 :

luciana nardo' ciao

de @ww-td66.proxy.aol.com :

It s very interesting to learn more about our cultur origin - sehr interessant fantastyczne ile ciekawych informacji mozna znalezc u was - I find it wonderfull that the World it is now so small !!! You are my Favorite

de @194.79.98.36 :

Yasser

de @prof.batc3.univ-paris8.fr :

dospeux

de @user-38lc5gc.dialup.mindspring.com :

Thank you for letting me use your letters in my school project! I got an "A"! Merci (I learned that in my French class!) RACHEL

de @www.trms.k12.fulton.ga.net :

Jessica Freeman

de @208.135.204.26 :

I've used your page as a reference in two of my grad. school projects. I teach World Civilization History and English and have found this site useful in the Ancient Civilization Unit.

de @208.135.204.26 :

I've used your page as a reference in two of my grad. school projects. I teach World Civilization History and English and have found this site useful in the Ancient Civilization Unit.

de @imsr_admin1.lex5.k12.sc.us :

coolwebsite

de @imsr_admin1.lex5.k12.sc.us :

egyptians rule

de @imsr_admin1.lex5.k12.sc.us :

do you know yan vargas

de @imsr_admin1.lex5.k12.sc.us :

whatup yo hws it going inthe egyptian hood

de @imsr_admin1.lex5.k12.sc.us :

Harrison Gray was here and daniel schomburg

de @imsr_admin1.lex5.k12.sc.us :

mr. hock man washere

de @imsr_admin1.lex5.k12.sc.us :

How could anybody be intrested in this

de @199.198.212.98 :

I do not know what is going on in the hip hop scean these days. Everyone seems to be into the ganster rap these days. I wish so of these so called "hip hopers" would shut the fuck up with there westside shit and injoy rap from all parts the conutry. for example, Acalone del, souls, freestyle fellowship, saphir. If anyone wants to have a good chat about hip hop drop me a line at my Emale gandolf09.

de @157.151.180.2 :

Ello! New technology is funny

de @1cust52.max10.houston.tx.ms.uu.net :

Ariel

de @195.188.91.1 :

MAAT is not only the essence of wisdom but also the measure of prudence. This principle guides the ambitious young scribe away from temptations which appear as opportunities... Maat is discipline because in most instances Maat is equated with balancing and measuring which in qualitative terms is reciprocity <a href=http://www.proweb.co.uk/~nshopland/manifest.htm>snodpous</a>

de @modem-061.iq.ca :

Allô les cocos!!!

de @ss7-13.inre.asu.edu :

More!!!! I need more info. And your info is very basic. Could you add a good website that 6th graders can use!! I'm not illliterate. I know alot already.I'm doing an Egyptian report on hieroglyps. I came to learn more!! MORE!!!!

de @border.nic.k12.ut.us :

Be-I ndiat

de @ppp239.245.mmtl.videotron.net :

Salut, comment ça va. oh moi très bien et toi!

de @sch2.clayms.johnston.k12.nc.us :

information on hierogliphics

de @macb545.drh.sg.cnrs-dir.fr :

c'est genial de nous offrir la possibilité de traduction en hieroglyphes!! je me fiance prochainement et j'ai fait le plan de table avec les prenoms de toute la famille en hieroglyphes!! Je pense que chacun trouvera sa place sans problème!!

de @207.35.93.254 :

je trouve ca pourri en criss

de @ww-tm06.proxy.aol.com :

Blake

de @204.98.18.125 :

I have enjoyed your page. Thank you for teaching me more than I knew.

de @px1.syd.aone.net.au :

Thanx so fuckn so much!!!

de @207.10.125.243 :

This is a cool site!

de @as7216.ppp-ext.uqam.ca :

Et bien un beau bravo. je suis étudiante en histoire au Québec. J'aimerais savoir comment faire pour s'abbonner à des sociétés d'histoire antique (Égypte).

de @ts1-35.f2001.quebectel.com :

Colette

de @wwws.uninetcom.it :

cosimo

de @blb-as7s25.erols.com :

bite me

de @www.kc.nhgs.tec.va.us :

please hurry we have a program in march and we still need info. Your site would be perfect for us. Thank You Lesley

de @1cust128.tnt1.san-bernardino.ca.da.uu.net :

I am so glad you are creating a page on Hier. I would be interested in knowing your colour schemes for letters as I wil l be using them for my artwork on my terra-cotta ware. Can you help? Maurizio V. Cattaneo

de @1cust95.max41.seattle.wa.ms.uu.net :

HI Everybody

de @193.92.81.183 :

f.o.a.d

de @s252-116.westonka.k12.mn.us :

ever did this page did a wonderful job on researchingr this topic. great job.

de @dialin2-111.wustl.edu :

well i like it but you need more history!

de @oa1ec.linst.ac.uk :

bonjour, je suis etudiant a londres en B.A print management je trouve votre rubrique interessante car elle trace un minimumm de caracteres hierroglyphiques. Anyway si vous pouviez en faire de meme pour le hierratic, demotic et coptic, j'en serai le plus heureux car je suis actuellenment a la recherche de ces alphabets. Si vous connaissez un site ou sont retranscrit ces caracteres svp faites le moi savoir> ci-joint mon imail adresse merci d'avance : d.lecardonnel1@lcpdt.linst.ac.uk

de @stgo120.dialup.reuna.cl :

Amazing, you are the perfect award for giving and sharing just beacuse of the love of it

de @198.234.127.43 :

Egypt is cool . Gotta go see ya !!!!

de @kubdds.kub.nl :

Now, I can start working on my paper about the ancient Egyptian Alphabet. Thanks a lot, because it was very useful information! Greetings from the Netherlands

de @143.217.68.114 :

Egypten Mumier och Pyramider

de @proxy.estaminas.com.br :

sergio matta musacchio

de @etud1 :

Speciale cacededi a Serge et toute sa mifa, YO !

de @sdn-ts-001dcwashp01.dialsprint.net :

This is really neat!!!

de @gubmac542.ub.gu.se :

I wonder why the letter L (often a sign of a lion) does not occure in the list of alphabetic sound of yhe hieroglyphes?

de @n207211033027.inetworld.net :

Bravo and good luck!

de @195.33.231.108 :

I LOVE THIS SITE

de @ppp46.soonet.ca :

i' cool and i want free donuts now please hello

de @148.202.30.79 :

awuntriqeru

de @gw.bas.roche.com :

moi j'aimerais bien retrouver cette satanee adresse qui permet de traduire du texte en hieroglyphe vite urgent . merci francois.herzog@roche.com

de @edslink3.eds.com :

la traduzione del nome in geroglifici e' bellissima: grazie!

de @194.79.153.101 :

je m'appelle angelique et je suis super heureuse d'avoir decouvert votre site

de @194.79.153.101 :

salut je m'appelle angelique est je suis super heureuse d'avoir decouvert ce site Tu peux me contacter FTSCORP@DSINET.FR

de @194.79.153.101 :

je m'appelle angelique et je suis super heureuse d'avoir decouvert votre site

de @206.254.177.118 :

Je m'appelles Vanessa et j'aimes ton page du hyroglyphs. A bientot!

de @208.224.102.221 :

How about a request? I need the following phrase converted to Hieroglyphics. "Man is the dream of the dolphin". I have used the translators on-line, but the graphics are not good. If you can help with some nice graphics or a complete alphabet (high quility graphics) I would be forever in your dept. Thanks Mike bbcardguy@geocities.com

de @dialup181-2-48.swipnet.se :

Linda

de @dial91.debbs.ndhq.dnd.ca :

I liked your page alot and it helped me alot in my project I am doing for school on ancient egypt,THANKS!

de @stortek1.stortek.com :

Thanks, I have been looking for something like this for a long time. Gracias, Yo habia estado buscando algo con que entender los Graffiti y no lo habia encontrado. Muchas gracias.. Lozadjf@puertorico.stortek.com

de @haarneson.uwsp.edu :

arne

de @libref4.capcollege.bc.ca :

mouarf g pas encor luy la page mais bon je vais m y lancer

de @158.122.20.26 :

Cafe Egipto Venga a comer

de @sanjuan-208-156-16-140.coqui.net :

este mural ha sido echo en el año 1998 antes del tercer milenio

de @www.republic.wednet.edu :

we are really cool

de @n105h052.thezone.net :

bravo et a bientot outstanding!!! WOW!

de @198.174.50.120 :

Hi!

de @198.174.50.120 :

ddr@ss12e

de @198.174.50.120 :

de@www-a2.proxy.aol,com:

de @204.184.206.203 :

hellooooooo! kramer.

de @www-proxy.digital.fr :

ARBRE DE VIE

de @www-proxy.digital.fr :

VIE

de @t3a69.t3a.com :

salut tout le monde je m'appelle julie CAMET ce site est super

de @lille2-45.hol.fr :

ERIC

de @mid-k.smus.bc.ca :

Hello Chad

de @198.188.44.185 :

We enjoyed your pictures B-8 Monte Vista School, Camarillo, CA USA

de @epimetheus.rz.uni-osnabrueck.de :

Edward

de @ppp037.117.mmtl.videotron.net :

Salut les copains.

de @206.79.191.109 :

Candace Gray

de @206.79.191.168 :

Pualani

de @206.79.191.109 :

Why can't I get my name in hieroglyphes?

de @204-88-144-092.sccoe.k12.ca.us :

hail won sucka

de @193.121.167.180 :

anaïck

de @209.12.85.23 :

This is really neat!!! I truly enjoyed your page! Thank you!!!

de @209.12.85.51 :

This web site is so cool! I liked looking up my name in hieroglyphes.

de @209.12.85.37 :

Hey Ann Morgan, I love Wrght Matthews!

de @209.12.85.37 :

Ann Morgan and Mason are not dating

de @207.94.168.14 :

WE WOULD LIKE YOU TO PUT A SITE WHICH HAS Ancient persian WRITING

de @158.103.103.222 :

zcxfgfghfgj

de @209.12.85.37 :

Hey Laura Lee, Ilove Wright

de @132.208.168.28 :

Four le monde

de @proxyca.grolier.fr :

un bonjour à une homonyme BORDRY qui travaille en Egypte

de @168.18.138.240 :

you killed kenny you bastards

de @168.18.138.240 :

sorry THOUGHT YOU WERE GOING TO SHOW WHAT MY GRAFFITI WOULD LIKE IN HIEROGLYPHS

de @ww-ta02.proxy.aol.com :

I love egypt. It is awesome

de @pool045-max1.gg-ca-us.dialup.earthlink.net :

WHAT ARE YOU DOING

de @145.bridgeton-09.mo.dial-access.att.net :

I have spent the past two hours on this website and have only seen a fraction of the info it has to offer. It is a very knowledgeable place to visit and I will visit it quite a bit. As I have nothing else to write at this time I will dismiss myself, peace to all.

de @utr52-24.utrecht.nl.net :

m

de @utr52-24.utrecht.nl.net :

source

de @mail.spearfish.k12.sd.us :

I really don't know what to look up on this page because I just don't know

de @194.23.163.127 :

fantastique

de @199.179.202.43 :

A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

de @ww-tn01.proxy.aol.com :

THIS IS COOL

de @asc8-addr-87.dsuper.net :

cest poche

de @pm16-10.magicnet.net :

Thank you so much for this page. It was exactly what I was searching for (Too bad it didn't come up first in AltaVista).

de @165.248.113.158 :

TO WHOM IT MAY CONCERN, WHY DON'T YOU DO A REPORT ON THE WASTE OF EYGPT. I AM STUDENT IN HAWAII. gregory bailey

de @ppp-zog-146.spm.it :

Gritti Giuliano

de @www.panservice.it :

Comme en peut ecrire le nome MICHELA par les graffitis

de @www.panservice.it :

Comme en peut ecrire le nome MICHELA par les graffitis pa2656@panservice.it

de @207.96.233.106 :

salue marie-pier

de @dev3.plainfield.k12.in.us :

CCCCCCOOOOOOOOOOOOOOOOOLLLLLLLLLLLL

de @intergate.ausd.k12.ca.us :

hieroglyphic's

de @intergate.ausd.k12.ca.us :

hieroglyphic's is fun to learn about

de @rasp13-164.abo.wanadoo.fr :

En direct de la fête de l'Internet France nous vous passons le bonjour!

de @proxy-aubervilliers.wanadoo.fr :

SLT SERGE superbes ce que tu fait moi aussi je suis très passioné par tout ce qui touche l'EGYPTE à l'epoque pharaonique et ton site est vraiment le meilleur de ce que j'ai pu voir jusqu'a present . MERCI POUR LE BOULOT QUE TU A FAIT. PATRICE.RAMPAL@wananadoo.fr

de @proxy-aubervilliers.wanadoo.fr :

SLT SERGE superbes ce que tu fait moi aussi je suis très passioné par tout ce qui touche l'EGYPTE à l'epoque pharaonique et ton site est vraiment le meilleur de ce que j'ai pu voir jusqu'a present . MERCI POUR LE BOULOT QUE TU A FAIT. PATRICE.RAMPAL@wananadoo.fr

de @proxyca.grolier.fr :

vive paris 8

de @p04-24.hartford.dialin.ntplx.com :

Le mouton et dans le Gare du Nord.

de @ww-tj03.proxy.aol.com :

Ancient Egypt has much to teach. Your website brings out the voices of the past.

de @ws20.nde.org :

Graffiti is cooooooooooooooooooool!!!!

de @ww-tb02.proxy.aol.com :

The anticipation is all I can stand just waiting to see your presentation. I hope to see it soon!!! Tom Chamberlain Evansville, IN Canndo1321@aol.com

de @fishkill-out.putnaminv.com :

samantha

de @mumford.prc.com :

marzette

de @caen2-3.abo.wanadoo.fr :

vraiment un tres bon site!merci!

de @dialup100-2-42.swipnet.se :

he

de @du-1121.claranet.co.uk :

excellent its what ive wanted to get me started the thing that go me into this great subject is a album cover by a band called Iron Maiden "POWERSLAVE" it has Hieroglyphs everywhere and i love to read them

de @206.29.60.171 :

The people were on a boat in the river

de @dns2.univ-orleans.fr :

Ce site est absolument génial !!!

de @206.87.24.96 :

navjot

de @ww-te06.proxy.aol.com :

A QUAND UN LOGICIEL POUR ECRIRE EN HIEROGLYPHE

de @tcmassy1-41.hol.fr :

J'aime ma famille et je souhaite l'aider, la protéger, la chérir tout au long de ma vie.

de @proxy-136.iap.bryant.webtv.net :

MIROSLAV VECKOVIC

de @proxy-111.iap.bryant.webtv.net :

HI TO EVERYBODY! MY NAME IS MIKE. I AM VERY INTERSTED IN EGYPTIAN HISTORY. I GOT PROBLEM I COULD NOT YET FIND THE NAME OF PHARAON WHO WAS NOT MARRIED, IF SOMEONE KNOW THE ANSWER ,PLEASE LEAVE ME THE MESSAGE.. THANKS VERY MUCH

de @02-200-02.ale.monroecc.edu :

I wish when I got on this internet I could find something that I actually wanted to find. I am looking to study different styles and types of taging.

de @193.252.218.1 :

rafael

de @ppp-109-33.villette.club-internet.fr :

maison

de @melun2-29.hol.fr :

je m'appelle martine AGIER j'ai 38 ans et je suis passionnée et fascninée par l'EGYPTE

de @206.10.218.35 :

this is the end of time 2001

de @pm1-32.pah.infi.net :

I like your site it is what the internet should be about interesting infirmative and educational.

de @world102.worldaccessnet.com :

The name to hieroglyphs converter is excellent! I like how it places the name in a cartouche and stacks some of the hiroglyphs rather than stringing them out in a row like other hieroglyph converters. I have placed this site on my links page.

de @ww-te05.proxy.aol.com :

Hello there I've been wasting a great deal of time trying to find a hieroglyphic font Could you please help? lucasgd@aol.com.uk

de @196.25.80.171 :

thanx for the great page...!!! i am busy doing a project on ancient egyp....and this is great...!!!!!!!!!!!!!!!!!!!!!!!!!!!!11 thanx once again

de @ww-te01.proxy.aol.com :

ernesto

de @fw.sumpqua.k12.or.us :

I would love to learn about the ancient ways\

de @saraas1-6.firn.edu :

Thanks for this page. We were participating in the World's Largest Math Event. We were looking for information on the pyramids. Our entire class translated our names and we are making an Egyptian scene. Your pictures were awesome. We can't go to Egypt but your pictures took us there. Duette Elementary, Florida, USA

de @132.33.208.182 :

It might be helpful to place the buttons (next, up, previous) at the bottom of the page. Thanks.

de @dialup46.tnblo.usit.net :

Page formidable. Tres belle introduction aux Hieroglyphs. Felicitations du Tennessee.

de @209.117.157.152 :

le site c'est merveilleux!! j'aime l'Egypte et francais. J'envoye ton site a mon prof francais. Je suis de Ohio aux Etats-Unis. Je regrette mon francais n'est pas bon. Je veut faire un site francais pour mon page maison, et je serais heureux pour ton aide. mon e-mail est: freebird3@hotmail.com

de @gemini.cs-haut-st-maurice.qc.ca :

salut men!!!!!!!!!!!!

de @206.140.206.104 :

Great Site!!

de @iutb-ipt-12.univ-lyon1.fr :

Je vois avec plaisir que LA RECHERCHE avance tres tres tres fort au LIFAC. Bravo Serge! Je le NOTE!

de @compuweb.compusep.com :

This page is wonderfull, are a window to know the egypsian culture

de @compuweb.compusep.com :

The page is the best Amado Barriga Solis; Zamora Michoacán México aime@discoverymail.com

de @ppp2-16.ruralnet.net :

Mad lyrics flow like blood through my viens. I think I'm going insane. I'm in this for the fame.

de @ppp25.intercom.es :

Alicia

de @usu159.100mbps.es :

erase una vez

de @fri13pub122.bluewin.ch :

EXTRA!!!

de @194.75.70.208 :

DANIEL

de @194.75.70.208 :

daniel

de @sar036.larural.es :

libert padua ciudadano libre del mundo saluda a sus colegas del la piramide del gran arquitecto

de @sar036.larural.es :

salud y libertad a todos /as los ciudadanos del mundo libre aqui un colega saludos a mi colega javi que estara durmiendo ahora

de @ia-13.arrakis.es :

ALBERTO

de @1cust171.tnt1.waipahu.hi.gt.uu.net :

We enjoyed typing in each family member's name. The Bruhns

de @204-245-98.ipt.aol.com :

I love all your wonderful pictures. I felt like I was literally standing in front of the spinx. I hope to one day visit Egypt. thanks!

de @pool046-max2.ds13-ca-us.dialup.earthlink.net :

I really enjoyed your site, please feel free to visit our WEB site with Egyptian products at: http://www.sahara-nairobi.com

de @gk-west.usps.gov :

shuron

de @165.248.104.243 :

ADESONE is here rock. And will fo'eva till the day that I Drop. Drip,drop,slip,Slop. Fuck The Cop.sssssssssssssssssssssssssssssss

de @165.248.104.243 :

ADESONE is here rock. And will fo'eva till the day that I Drop. Drip,drop,slip,Slop. Fuck The Cop.sssssssssssssssssssssssssssssss

de @142.217.234.92 :

J'ai hâte de recevoir la vraie page. Mon nom commence par oiseau oiseau marcel.lheureux@sympatico.ca Salut!

de @mistral.culture.fr :

Salut, je suis une éléve de Goyon a LYON, c'est pas mal ce que tu as fait ! Enfin, je ne dirais rien sur - ecrire son nom en hieroglyphes - !!! Je n'ai pas pu acceder a la page du copte, ca nous interresserait bien, voici mon e.mail : cchomer%hisgeo@etud.univ-Lyon2.fr , a bientot j'espere. Claire

de @ts1-41.f2003.quebectel.com :

salut, c`est vraiment génial tes recherches, continue, on en a tous besoin..merci

de @www-fw-proxy5.boeing.com :

Salve Serge. Pagina aranei tua magna est et ea studium multum edidit. Sed memento Aegyptus provincia Romae est.

de @proxy.interactiva.net :

BATMAN NO EXISTE "ROBIN"

de @proxy.interactiva.net :

BATMAN NO EXISTE ,ROBIN

de @lucky-link-gw.bit.ll.net.ua :

C'est formidable! La realisation d'un reve exotique de qui est amoureux de l'Egypte Ancien. Un grand salut de l'Ukraine.

de @ts002d22.sun-fl.concentric.net :

Your Site is very cool it just need's to be Updated and finish the construction, 1995 update to 1998,other than that I love and I'll be back...... :) "98"

de @dyn35.island.net :

wonderful, what a marvelous site. will visit again

de @linux.cscharlesbourg.qc.ca :

va chier!!!

de @linux.cscharlesbourg.qc.ca :

cool patate!!ca boom?

de @simpson-bh.smpsn.com :

What a great site!

de @ppp-91.lowville.northnet.org :

can you find me a site that translates heirogliphics to english

de @proxy.nordnet.fr :

je sais pas trop quoi taper moi

de @di115-5.chilesat.net :

I'm from Chile, South America, and I was searching in a lot of old books and stuff how to write or understand hieroglyphs... and your site was like a heaven to me!! Je ne parle pas beaucoup Français, mais J'aime l'Egypte! It was a great idea to create this page!! I'm 16 years and I'm right now on my last year in High School (le lyceé), and soon I hope to study more about Ancient Egypt! Do you like the movie "Stargate"? I think they called "Eye of Re" to the "Eye of Horus", am I wrong? Anyway, I loved that movie, and it had some cool stuff about the Gods (Re appearing for the first time with his arms extended... I think that means that the God's power extends to all his body, really?) Anyway, keep up the work on this site, Ah! And please include the "Plural of Nouns" page and the "Adverbial Sentence" page!! Also... do you know which one if the best University to study about Ancient Egypt? Sara Salazar fsubzero@hotmail.com

de @di115-5.chilesat.net :

I'm from Chile, South America, and I was searching in a lot of old books and stuff how to write or understand hieroglyphs... and your site was like a heaven to me!! Je ne parle pas beaucoup Français, mais J'aime l'Egypte! It was a great idea to create this page!! I'm 16 years and I'm right now on my last year in High School (le lyceé), and soon I hope to study more about Ancient Egypt! Do you like the movie "Stargate"? I think they called "Eye of Re" to the "Eye of Horus", am I wrong? Anyway, I loved that movie, and it had some cool stuff about the Gods (Re appearing for the first time with his arms extended... I think that means that the God's power extends to all his body, really?) Anyway, keep up the work on this site, Ah! And please include the "Plural of Nouns" page and the "Adverbial Sentence" page!! Also... do you know which one if the best University to study about Ancient Egypt? Sara Salazar fsubzero@hotmail.com

de @ppp70.vif.com :

cette idee est tres amusante

de @ppp70.vif.com :

cette idee est tres amusante

de @207.50.165.165 :

I like this one. It's the best one.

de @mistral.culture.fr :

Salut c'est encore moi, l'assidue éléve de Goyon (j'ai eu 16.5 à mon partiel, tu t'en fous mais c'était dur : un texte de Sinouhé avec un pseudo-participe...), je n'arrive décidement pas à accéder à ce que je veux : correction des exos de Gardiner (c'est si pratique!! même si ça ne sert en fait à rien : comment progresser alors?) les bases de données de Lyon, mais c'est peut-etre la ministere de la culture... Bon, si tu as un tuyau pour arriver à toutes ces pages qui me font tant envie, tu as déjà mon e-mail. A bientot j'espère. Claire.

de @afrodita.etsimo.uniovi.es :

searched for a long time a book in spanish of hieroglyphs. I can not find it. At least, now i now my name in Hieroglyphs. This is great for people interested in Egyptology

de @192.93.12.104 :

Super! "Seshnesu" enfin un outil ideal pour taper des hieroglyphes

de @192.93.12.104 :

Super! "Seshnesu" enfin un outil ideal pour taper des hieroglyphes

de @dietnut2.his.ucsf.edu :

How do you write the word "friendship" in Hieroglyphs? I'd love to know. And do you know of any neat Egyptian stories pertaining to friendship or love? Thank you. steenlan@email.his.ucsf.edu

de @s210.beeline.ca :

Bonjour tout le monde! J'habite au Canada, et je pense que cette page est tres bonne. J'aime beaucoup les hyroglyphs. http://members.xoom.com/Spamguy (anglais)

de @kad-a5-08-asy40.kad-ro-03.superonline.com :

bogac

de @kad-a5-08-asy40.kad-ro-03.superonline.com :

skarabaen

de @194.51.223.1 :

Votre site n'est pas mal du tout!! Bravo! autres passionés de l'Egypte Ancienne, vous pouvez me retrouver au: Charl11748@aol.com. A bientôt

de @web3.infonie.fr :

de juge01infonie fr ce site est beau , ce site est beau , ce site est beau je vous le dis , ce site est beau ce site est beau ! et ça se chante ! merci serge de nous faire partager ta passion pour l'egypte c'est beau et bien fait ma fille aura droit a y venir !

de @shadow1.fresno.k12.ca.us :

This is a cool page

de @pop-toulouse-106.easynet.fr :

C'est excellent Une très bonne approche et donne envie d'en savoir plus

de @ciscopridial4.dialup.satelnet.fr :

Pour la pierre de rosette, j'aurai beaucoup aimé pouvoir répondre. Mais je ne dispose pas de photo numérisée. Pourquoi ne pas poser la question sur un forum de chercheurs historiens?

de @207.194.177.53 :

ahjahla is searching for historical reference...peace

de @130.104.28.222 :

Chut !!! Je travaille ! Mais super !

de @host-209-214-106-178.bhm.bellsouth.net :

www.Lords of the Relm.com

de @host-209-214-106-178.bhm.bellsouth.net :

tthe lord of the relm is cool you can play real pepole ther on the wed site

de @194.167.104.12 :

salut à TOI prince des ARDECHIES

de @pc194.bcc.cc.tx.us :

I AM ALWAYS IN EGYPTIAN LIFE I WOULD LIKE TO BE AN ARCHEOLOGIST SOMEDAY MY DREAM IS TO FIND SOMETHING THAT NO ONE HAS AND STUDY IT WITH NO CLUE WHAT I AM LOOKING AT

de @206.48.244.220 :

Hola, soy Ricardo, estoy perdido en esta página porque a mi lo que me gusta son los go-karts. Ni pedo, a ver como le hago para salirme

de @200.251.3.188 :

Please send me a Hierogliphs alphabet!!! Thank you metal@prover.com.br

de @zhb5pub108.bluewin.ch :

De reymond@bluewin.ch Quelle découverte! je n'ais pas encore été dans tous les recoins de ton sanctuaire, mais j'aime chercher et découvrir.Bravo Serge et merci pour tes recherches de haut niveaux et ton site qui tourne rond.. Amitiés.MR. :-))

de @p49-lorikeet-gui.tch.virgin.net :

This is a very good w.w.w thanks

de @nymphette.infonie.be :

SALUT MOI C'EST JOHAN DE BRUXELLES J'AIME BEAUCOUP L'EGYPTE.. SUPER TA PAGE WEB

de @ppp-varese86-150.iol.it :

GALMARINI SERGIO

de @alajuela1-a45.racsa.co.cr :

Those Americans just type COOL ! We Hispanics talk a lot, but let me try make it shot: Muchas Gracias (Merci ???) Finaly, a site that works, without all that stupid pictures, and moving links that just make you dizzy. Keep the good work.

de @204.56.140.19 :

Please get this running. I am anxious to learn everything I can about ancient Egyptian hieroglyphics!

de @spider-wd024.proxy.aol.com :

Interesting

de @webproxy02a.smb.com :

jason

de @spider-tl022.proxy.aol.com :

wendy

de @cbsa25-01-p02.wc.saix.net :

hvala na lepim slikama i informacijama, dodchi chu opet to je sigurno.

de @proxy-163.iap.bryant.webtv.net :

This is great page I learned a lot from the hieroglyphs. kissylyn@webtv.net

de @proxy-163.iap.bryant.webtv.net :

This is great page I learned a lot from the hieroglyphs. kissylyn@webtv.net

de @t7o15p13.telia.com :

Ra

de @cpi-telefonica.telefonica.es :

mario

de @slip166-72-141-67.tx.us.ibm.net :

I have been a Hot Rodder for years, and as such always looking for somthing different. My name on the back in hierogylphics was great! Thanks!

de @ts1-23.f3202.quebectel.com :

Merci Serge. J'ai des amis qui sont des fans de tout ce qui touche A l'Égypte je vais leur offrir leur nom en hiéroglyphe comme cadeau. Je vais les faire agrandir et peindre. Ils vont adorer. Bien le bonjour du Québec

de @ppp-brescia84-118.iol.it :

ciao sono marco inselvini

de @171-55-198.ipt.aol.com :

Most of the pages are in French. I would like to know if they are in English so I can read them.

de @firewall-ext.pldi.net :

This is cool I like the way my name was wrote

de @cpi-telefonica.telefonica.es :

mario

de @cache-hki-112.inet.fi :

anna-jasmin

de @194.65.128.97 :

j'aime l'egypte. J'ais fait une tattoo de l'oeil sacré de le Dieu Horus

de @ts1-04.f3207.quebectel.com :

Très pratique..je m'en suis servi pour faire justement des graffitis hallucinants près de chez nous (Montréal)

de @195.75.25.3 :

Peut on recevoir les hiéroglyphes correspondant au nom sous forme de fichier bmp ?

de @srv1s19.saglac.qc.ca :

WOOOOOOOOOWWWWWWWWWWWWW! C'EST SUPER.

de @198.209.198.195 :

I am a frog lover

de @mod5.super.com.br :

I loved this page abou egypt, it is very intresting, mainly because I like the history and life of the egyptian! Congratulations!!! Andy lima, 18 years, Brasil, Curitiba, Pr

de @mod5.super.com.br :

This page help a lot (Esta página me ajudou muito). Mainly because I like of the egyptians history(principalmente porque eu gosto da hisória egípcia) Gostaria de saber mais sobre Tutankhamon!! Andressa Lima, 18 anos, BRASIL, Ctba, Pr Muuuuuuuuito legalllllllllllllllll!!!!

de @s61-40.osseo.k12.mn.us :

thanks man for all the info it will really help

de @spider-wg011.proxy.aol.com :

hello. i always loved learning about egypt ever since the movie stargate... and out of all the books and pages that i read i believe you really work hard toward this page... thank you for this page for then i wouldnt have seen my name in hieroglyphics! Keep up the great work!!!

de @sc512.utm.mx :

saludos de Mexico, tengo mi nombre en jeroglificos en la espalda..

de @pd13-174.par.compuserve.com :

Merci pour la page. Serait-il possible d'avoir davantage de textes hyéroglyphiques plutôt que des traductions?

de @pintado.dae.inpe.br :

Ivan Jelinek Kantor

de @196-31-64-41.iafrica.com :

HIEROGLYPHISC

de @host3.mtahs.svsu.org :

Merci .Je me Joue toujours mais Je abus mon chien.

de @164.138.142.2 :

Bonjours, je suis passionne par l'egpte antique et je recherche d'autres pasionnés. GEOFFROY.PERNEL@wanadoo.fr

de @proxy.zip.com.au :

I have a history project due soon and I would like to thank you for the help your web page has given me melci beaucupe, Lachlan Howe(age13)

de @proxy.zip.com.au :

I have a history project due soon and I would like to thank you for the help your web page has given me (In french too) merci beaucoup, Lachlan Howe(age13)

de @h-207-228-66-45.dial.cadvision.com :

what is the graffiti

de @spider-tr041.proxy.aol.com :

i have to do a research assignment on ancient egyptian heiroglyphs an dyour site was very helpful. but as i am a design student a noticed that it was lacking color and life. i suggest that you perhaps do something about this so that it makes your good site a "great" site. thanx mick. email: crapweazel@hotmail.com

de @s200.ccsis.com :

Am trying to find out if a 14 year old boy had anthing to do with decifering the writings on The Rosetta Stone

de @s200.ccsis.com :

Am trying to find out if a 14 year old boy had anything to do with decifering The Rosetta Stone ?

de @s200.ccsis.com :

Am trying to find out if a 14 year old boy had anthing to do with decifering the writings on The Rosetta Stone

de @dial221.netutah.com :

thank you for a verry interesting and informitive tour. we enjoyed it verry much

de @204.211.126.81 :

Iwant my name in hieroglyphics

de @bess-proxy.chicago.avenew.com :

Regina

de @m6714.direcpc.net :

Patrick St-Jean

de @1e030_pc_1-ne.herts.ac.uk :

Mental Site

de @dial156.triang.com.br :

odair

de @client32.bplorraine.fr :

coucou!!! c'est moi, eh oui je suis Toutankâmon je viens juste de sortir de mon sarcophage pour revoir la lumiere de Râ

de @client32.bplorraine.fr :

coucou!!! c'est de nouveau Toutankâmon qui vous parle.Après avoir revu la lumière de Râ,je vais revoir l'eau du Nil

de @client32.bplorraine.fr :

Eh! c'est toujours Toutankâmon en personne!Alors un peu de respect!

de @client32.bplorraine.fr :

Mon Dieu,c'est horrible! Je viens de voir MA dépouille dans une vitrine! J'en ai parlé à mon ami Ramsès II,mais il n'a pas réussit à me remonter le moral.Alors s'il vous plait, venez conforter une personne désespérée et répondez moi en commençant votre phrase par: A mon Pharaon: blablabla blablabla blablabla... Merci de tout coeur! signé: Pharaon.

de @spider-tq014.proxy.aol.com :

Thank you so much!

de @170.141.245.138 :

Thank you so much for this website. My sixth grade class is studying Ancient Egypt , and we are trying our hand at writing our names in hieroglyphics. This site gave me a "hands-on" example. Thanks again :) Vickie Gregory Greeneville, Tennessee USA

de @usr-cosh-m9-r209.clover.net :

hi

de @perceval.csbe.qc.ca :

HFY7HYRFU86RJ6

de @perceval.csbe.qc.ca :

HFY7HYRFU86RJ6

de @perceval.csbe.qc.ca :

HFY7HYRFU86RJ6

de @perceval.csbe.qc.ca :

NIAISEUX

de @proxy.span.ch :

salut à tous et à toutes Aimerai echanger info et anecdote sur l'Egypte ecrivez moi: taa@span.ch Amitiés futur

de @ip44.saint-louis2.mo.pub-ip.psi.net :

Greetings from St. Louis , Missouri, USA. I love your web page. You have done a very good job on it. Thankyou

de @usm-0046-73.wans.net :

Thank you for your efforts! Merci et Salut

de @espresso.virtual-cafe.com :

Thanks! You have brought hieroglyphics and Egyptian culture to 23 first graders in Seattle

de @p411-053.ppp.get2net.dk :

Her dit navn skrvet på ægptisk

de @p411-053.ppp.get2net.dk :

Her dit navn skrvet på

de @p411-053.ppp.get2net.dk :

Her dit navn skrvet